SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379741038|ref|YP_005333007.1| from Vibrio cholerae IEC224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379741038|ref|YP_005333007.1|
Domain Number 1 Region: 196-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-78
Family B3/B4 domain of PheRS, PheT 0.0000119
Further Details:      
 
Domain Number 2 Region: 467-689
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.84e-54
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 40-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.39e-47
Family Myf domain 0.0025
Further Details:      
 
Domain Number 4 Region: 697-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.35e-30
Family Anticodon-binding domain of PheRS 0.00078
Further Details:      
 
Domain Number 5 Region: 403-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.39e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379741038|ref|YP_005333007.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Vibrio cholerae IEC224]
Sequence
MKFSESWLREWVNPAITTDELTHQITMAGLEVDDVLAVAGVFDGVKVGHVVECAQHPDAD
KLRVTKVDVGEEELLDIVCGAANCRQGLKVAVATVGATLPGDFKIKKAKLRGQPSHGMLC
SFSELGIDVESNGIMELAENAPIGMDFRDFLSLNDVTIDVDLTSNRADCFSIRGLAREVG
VLNRADVTAPAVNAIVATINDTISIDVKAPAACPRYLGRIVKNVNVQAQTPLWMQEKLRR
CGIRSIDPVVDITNFVMLEQGQPMHAFDLAKIEGGIVVRLAEQDEKLTLLDGSEAKLNAD
TLVIADQQKALAIAGVFGGEHSGVSTDTKDVLLECAFFAPDHIRGRARSYGLHTDSSMRF
ERGVDYALQHAAMERATQLLVEICGGDVAPVVAAESAADLPKPNQVALRRSKLDKLLGHA
IPDADVVEILERLGMQVETTAEGWQATAPTWRFDIAIEQDLVEEVGRIYGYNNIPNQAPV
AALNMNLHNEAKLPLKRVRDLLVDRGYQEAITYSFVEPEQQKLVVPGVDALILPNPISAE
MSAMRLSLIQGLLNTVVHNQKRQQPRVRLFEYGLRFIPDAAAENGMRQEPMLAGVISGAR
GEEHWNMETATVDFFDMKGDLEAVLELTAKGKAYSFAATKHPALHPGQAAAIMVDGKAIG
VIGTVHPELERKFGLNGRTIVFEIEWNAINTRVIPEAAAISKFPANRRDIALVVDGNIAS
GDIVEACRVAGGELLKDAKLFDVYVGKGVEEGKKSLAIALTLQSVERTLEEADIAAAVEA
IVQAVSAQFGAALRD
Download sequence
Identical sequences A0A0H3PXD8 A0A0H6VU73 A0A0K9UX67 A0A0X1KVU6 C3LLR6 Q9KSN6
gi|227081392|ref|YP_002809943.1| 243277.VC1220 579112.VCM66_1175 593588.VCD_003125 gi|15641233|ref|NP_230865.1| gi|229608207|ref|YP_002878855.1| NP_230865.1.72393 WP_000672448.1.100264 WP_000672448.1.100388 WP_000672448.1.100440 WP_000672448.1.10071 WP_000672448.1.100976 WP_000672448.1.101117 WP_000672448.1.10121 WP_000672448.1.101220 WP_000672448.1.101314 WP_000672448.1.101507 WP_000672448.1.101933 WP_000672448.1.102054 WP_000672448.1.1024 WP_000672448.1.10626 WP_000672448.1.10834 WP_000672448.1.10887 WP_000672448.1.11270 WP_000672448.1.11879 WP_000672448.1.11885 WP_000672448.1.11965 WP_000672448.1.12262 WP_000672448.1.12332 WP_000672448.1.12525 WP_000672448.1.12527 WP_000672448.1.12548 WP_000672448.1.12590 WP_000672448.1.12686 WP_000672448.1.13053 WP_000672448.1.13155 WP_000672448.1.13156 WP_000672448.1.13454 WP_000672448.1.13652 WP_000672448.1.13725 WP_000672448.1.14080 WP_000672448.1.14257 WP_000672448.1.14263 WP_000672448.1.14904 WP_000672448.1.14995 WP_000672448.1.15109 WP_000672448.1.15179 WP_000672448.1.15200 WP_000672448.1.15516 WP_000672448.1.15786 WP_000672448.1.15997 WP_000672448.1.16351 WP_000672448.1.16382 WP_000672448.1.17232 WP_000672448.1.17295 WP_000672448.1.17621 WP_000672448.1.18375 WP_000672448.1.18392 WP_000672448.1.18447 WP_000672448.1.18577 WP_000672448.1.18862 WP_000672448.1.18916 WP_000672448.1.19126 WP_000672448.1.19128 WP_000672448.1.19442 WP_000672448.1.19503 WP_000672448.1.20065 WP_000672448.1.20107 WP_000672448.1.20379 WP_000672448.1.20404 WP_000672448.1.20669 WP_000672448.1.20699 WP_000672448.1.20758 WP_000672448.1.21073 WP_000672448.1.21281 WP_000672448.1.21558 WP_000672448.1.21671 WP_000672448.1.21717 WP_000672448.1.21764 WP_000672448.1.21815 WP_000672448.1.21866 WP_000672448.1.22521 WP_000672448.1.22773 WP_000672448.1.229 WP_000672448.1.2304 WP_000672448.1.23333 WP_000672448.1.2341 WP_000672448.1.23416 WP_000672448.1.23424 WP_000672448.1.23538 WP_000672448.1.2354 WP_000672448.1.23808 WP_000672448.1.23955 WP_000672448.1.240 WP_000672448.1.2401 WP_000672448.1.24280 WP_000672448.1.24345 WP_000672448.1.24399 WP_000672448.1.24980 WP_000672448.1.26020 WP_000672448.1.26156 WP_000672448.1.2627 WP_000672448.1.26326 WP_000672448.1.26508 WP_000672448.1.26580 WP_000672448.1.27186 WP_000672448.1.27435 WP_000672448.1.27458 WP_000672448.1.27639 WP_000672448.1.27863 WP_000672448.1.28431 WP_000672448.1.28508 WP_000672448.1.29095 WP_000672448.1.29535 WP_000672448.1.29708 WP_000672448.1.29889 WP_000672448.1.30107 WP_000672448.1.30292 WP_000672448.1.3032 WP_000672448.1.30360 WP_000672448.1.3054 WP_000672448.1.30927 WP_000672448.1.31096 WP_000672448.1.31718 WP_000672448.1.32264 WP_000672448.1.32271 WP_000672448.1.32814 WP_000672448.1.32955 WP_000672448.1.33093 WP_000672448.1.33625 WP_000672448.1.33811 WP_000672448.1.33819 WP_000672448.1.34108 WP_000672448.1.34195 WP_000672448.1.34261 WP_000672448.1.34634 WP_000672448.1.3514 WP_000672448.1.35201 WP_000672448.1.35266 WP_000672448.1.35630 WP_000672448.1.35880 WP_000672448.1.35881 WP_000672448.1.3635 WP_000672448.1.36354 WP_000672448.1.36441 WP_000672448.1.36668 WP_000672448.1.36686 WP_000672448.1.36874 WP_000672448.1.37054 WP_000672448.1.37262 WP_000672448.1.37676 WP_000672448.1.37784 WP_000672448.1.37999 WP_000672448.1.38420 WP_000672448.1.38590 WP_000672448.1.39514 WP_000672448.1.39675 WP_000672448.1.39853 WP_000672448.1.39933 WP_000672448.1.40039 WP_000672448.1.40152 WP_000672448.1.40433 WP_000672448.1.40459 WP_000672448.1.40470 WP_000672448.1.40484 WP_000672448.1.40491 WP_000672448.1.40542 WP_000672448.1.40571 WP_000672448.1.40740 WP_000672448.1.41573 WP_000672448.1.4175 WP_000672448.1.42128 WP_000672448.1.42152 WP_000672448.1.42498 WP_000672448.1.42617 WP_000672448.1.4272 WP_000672448.1.42783 WP_000672448.1.4284 WP_000672448.1.42853 WP_000672448.1.43335 WP_000672448.1.4365 WP_000672448.1.43884 WP_000672448.1.439 WP_000672448.1.44569 WP_000672448.1.44709 WP_000672448.1.44730 WP_000672448.1.45055 WP_000672448.1.45127 WP_000672448.1.45155 WP_000672448.1.45264 WP_000672448.1.45372 WP_000672448.1.45704 WP_000672448.1.45842 WP_000672448.1.45958 WP_000672448.1.46118 WP_000672448.1.46146 WP_000672448.1.4661 WP_000672448.1.47202 WP_000672448.1.4730 WP_000672448.1.4731 WP_000672448.1.47428 WP_000672448.1.47736 WP_000672448.1.47796 WP_000672448.1.47846 WP_000672448.1.47942 WP_000672448.1.48128 WP_000672448.1.48715 WP_000672448.1.488 WP_000672448.1.48927 WP_000672448.1.49238 WP_000672448.1.49317 WP_000672448.1.50277 WP_000672448.1.50577 WP_000672448.1.50625 WP_000672448.1.50822 WP_000672448.1.50980 WP_000672448.1.51177 WP_000672448.1.51661 WP_000672448.1.5201 WP_000672448.1.52391 WP_000672448.1.5320 WP_000672448.1.53214 WP_000672448.1.5397 WP_000672448.1.54191 WP_000672448.1.5425 WP_000672448.1.54398 WP_000672448.1.5450 WP_000672448.1.54706 WP_000672448.1.54901 WP_000672448.1.55092 WP_000672448.1.55665 WP_000672448.1.55929 WP_000672448.1.55932 WP_000672448.1.56429 WP_000672448.1.56785 WP_000672448.1.56807 WP_000672448.1.57148 WP_000672448.1.57300 WP_000672448.1.57518 WP_000672448.1.57546 WP_000672448.1.57678 WP_000672448.1.57945 WP_000672448.1.58295 WP_000672448.1.58596 WP_000672448.1.58844 WP_000672448.1.58975 WP_000672448.1.59010 WP_000672448.1.59194 WP_000672448.1.59554 WP_000672448.1.59633 WP_000672448.1.59741 WP_000672448.1.59916 WP_000672448.1.60386 WP_000672448.1.60694 WP_000672448.1.60955 WP_000672448.1.61169 WP_000672448.1.61523 WP_000672448.1.61644 WP_000672448.1.61753 WP_000672448.1.61869 WP_000672448.1.61875 WP_000672448.1.61935 WP_000672448.1.62165 WP_000672448.1.62324 WP_000672448.1.62425 WP_000672448.1.63347 WP_000672448.1.63546 WP_000672448.1.63655 WP_000672448.1.6366 WP_000672448.1.63723 WP_000672448.1.63749 WP_000672448.1.63779 WP_000672448.1.63911 WP_000672448.1.64201 WP_000672448.1.64253 WP_000672448.1.64315 WP_000672448.1.64382 WP_000672448.1.64441 WP_000672448.1.65007 WP_000672448.1.65051 WP_000672448.1.65086 WP_000672448.1.66329 WP_000672448.1.66633 WP_000672448.1.66696 WP_000672448.1.67616 WP_000672448.1.68424 WP_000672448.1.68506 WP_000672448.1.68723 WP_000672448.1.68925 WP_000672448.1.69049 WP_000672448.1.69843 WP_000672448.1.69857 WP_000672448.1.70069 WP_000672448.1.70176 WP_000672448.1.70247 WP_000672448.1.7049 WP_000672448.1.70813 WP_000672448.1.71129 WP_000672448.1.72106 WP_000672448.1.72326 WP_000672448.1.72361 WP_000672448.1.72369 WP_000672448.1.7238 WP_000672448.1.72480 WP_000672448.1.72856 WP_000672448.1.73148 WP_000672448.1.73429 WP_000672448.1.73555 WP_000672448.1.73855 WP_000672448.1.73929 WP_000672448.1.74111 WP_000672448.1.74503 WP_000672448.1.74666 WP_000672448.1.74991 WP_000672448.1.75012 WP_000672448.1.75326 WP_000672448.1.76425 WP_000672448.1.76486 WP_000672448.1.7654 WP_000672448.1.76645 WP_000672448.1.77029 WP_000672448.1.7717 WP_000672448.1.77355 WP_000672448.1.77397 WP_000672448.1.77445 WP_000672448.1.77703 WP_000672448.1.77794 WP_000672448.1.77830 WP_000672448.1.77914 WP_000672448.1.78157 WP_000672448.1.78531 WP_000672448.1.79044 WP_000672448.1.79776 WP_000672448.1.79943 WP_000672448.1.80024 WP_000672448.1.8023 WP_000672448.1.80339 WP_000672448.1.80500 WP_000672448.1.80618 WP_000672448.1.80628 WP_000672448.1.80702 WP_000672448.1.80744 WP_000672448.1.80808 WP_000672448.1.8117 WP_000672448.1.81871 WP_000672448.1.81917 WP_000672448.1.82119 WP_000672448.1.82193 WP_000672448.1.82248 WP_000672448.1.82262 WP_000672448.1.82413 WP_000672448.1.82583 WP_000672448.1.83040 WP_000672448.1.83073 WP_000672448.1.83082 WP_000672448.1.83109 WP_000672448.1.83703 WP_000672448.1.83761 WP_000672448.1.84385 WP_000672448.1.84519 WP_000672448.1.84610 WP_000672448.1.8480 WP_000672448.1.85007 WP_000672448.1.85086 WP_000672448.1.85498 WP_000672448.1.85822 WP_000672448.1.85878 WP_000672448.1.85961 WP_000672448.1.85972 WP_000672448.1.85998 WP_000672448.1.86057 WP_000672448.1.86192 WP_000672448.1.86269 WP_000672448.1.86874 WP_000672448.1.86879 WP_000672448.1.87274 WP_000672448.1.87335 WP_000672448.1.87355 WP_000672448.1.87573 WP_000672448.1.87602 WP_000672448.1.87804 WP_000672448.1.88057 WP_000672448.1.88230 WP_000672448.1.88283 WP_000672448.1.88350 WP_000672448.1.88556 WP_000672448.1.8867 WP_000672448.1.89441 WP_000672448.1.89447 WP_000672448.1.89822 WP_000672448.1.89889 WP_000672448.1.89995 WP_000672448.1.90133 WP_000672448.1.90227 WP_000672448.1.90437 WP_000672448.1.90675 WP_000672448.1.90774 WP_000672448.1.90889 WP_000672448.1.91247 WP_000672448.1.91262 WP_000672448.1.91274 WP_000672448.1.91539 WP_000672448.1.91747 WP_000672448.1.91794 WP_000672448.1.91841 WP_000672448.1.92038 WP_000672448.1.92063 WP_000672448.1.92069 WP_000672448.1.92157 WP_000672448.1.92401 WP_000672448.1.92516 WP_000672448.1.92559 WP_000672448.1.92696 WP_000672448.1.92703 WP_000672448.1.92952 WP_000672448.1.92993 WP_000672448.1.9302 WP_000672448.1.93060 WP_000672448.1.93399 WP_000672448.1.93836 WP_000672448.1.93945 WP_000672448.1.94255 WP_000672448.1.94426 WP_000672448.1.94441 WP_000672448.1.94481 WP_000672448.1.94887 WP_000672448.1.95516 WP_000672448.1.95549 WP_000672448.1.9561 WP_000672448.1.95662 WP_000672448.1.95733 WP_000672448.1.95976 WP_000672448.1.96001 WP_000672448.1.9607 WP_000672448.1.96089 WP_000672448.1.96187 WP_000672448.1.96311 WP_000672448.1.96471 WP_000672448.1.9660 WP_000672448.1.96687 WP_000672448.1.96693 WP_000672448.1.96704 WP_000672448.1.96980 WP_000672448.1.97100 WP_000672448.1.97144 WP_000672448.1.97516 WP_000672448.1.97552 WP_000672448.1.97650 WP_000672448.1.97799 WP_000672448.1.97832 WP_000672448.1.9787 WP_000672448.1.98021 WP_000672448.1.98116 WP_000672448.1.98172 WP_000672448.1.98246 WP_000672448.1.98280 WP_000672448.1.98624 WP_000672448.1.98642 WP_000672448.1.99128 WP_000672448.1.99204 WP_000672448.1.99417 WP_000672448.1.99452 WP_000672448.1.995 WP_000672448.1.99872 WP_000672448.1.99949 WP_000672448.1.99992 gi|360035123|ref|YP_004936886.1| gi|379741038|ref|YP_005333007.1| IDP90870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]