SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926445|ref|YP_003323068.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926445|ref|YP_003323068.1|
Domain Number 1 Region: 315-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-70
Family RecA protein-like (ATPase-domain) 0.0000000586
Further Details:      
 
Domain Number 2 Region: 277-334
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000343
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 
Domain Number 3 Region: 229-272
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000192
Family Rho termination factor, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926445|ref|YP_003323068.1|
Sequence length 642
Comment transcription termination factor Rho [Thermobaculum terrenum ATCC BAA-798]
Sequence
MDNTKNQELERNSEEIATTTITEIPADTRASDPQQSQQAHDTDKQPSDQIASDNVEPGNV
TSEKSSEDQLELPISEQRVENTPEVATEVPTSQQSSMHTQGDNSSNSKQADTSVVTEQSA
EPDPPVAEVTKVAEVGQQEEQAEHREDAAQEPSSTTTVAEEATSEAATPPEVDKAEEKPS
SKRSKKKPKQNNGRNGNNQQERTNGNNTAVAVAKKPSNETETVQAPTFTFAELQSMTKTN
LLALGRSLEVEVSGSMTKETLIYKILEAQANRAGYLLKQGILDIIEDGFGFLRQERYLPS
PDDVYVSQSQIRRFGLRTGDHVIGQVRAPKDNEKYHSLLRVEAVNYMDPEAARKRPFFDQ
LTPIFPNRQLVLETTPKQLSTRLIDLVAPIGRGQRGLIVSPPKAGKTTLLKDIANGITHN
YDDVHLMMLLIGERPEEVTDIRRSVEGEVVASTFDEPVEDHTKVAEMALERAKRLVECGK
DVVILMDSITRLARAYNLVVPASGRTLSGGIDPVALYPPKRFFGAARNIDEGGSLTIIAT
CLIDTGSRMDDVIYEEFKGTGNMELHLDRKLQERRIFPAIDVQRSGTRREELLIPEPKLQ
KIWTMRRMVSMLGGLEGTELLLNRLAKTENNEEFLNTLNKEL
Download sequence
Identical sequences D1CBT1
WP_012875281.1.85100 525904.Tter_1339 gi|269926445|ref|YP_003323068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]