SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295130286|ref|YP_003580949.1| from Propionibacterium acnes SK137

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295130286|ref|YP_003580949.1|
Domain Number 1 Region: 32-310
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.08e-63
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|295130286|ref|YP_003580949.1|
Sequence length 559
Comment cytochrome b/b6 family protein [Propionibacterium acnes SK137]
Sequence
MARPTGIAEESPTLRTATADDKPTGRGMRIVNWHDDRLGLAKMGKENLRKVFPDHWSFLL
GEIALYSFVALLLTGVFLTIWFKPSMAEVDYTGPYQLLKGTPMSEAFASTLDLSFEVRGG
LLIRQIHHWAAILFVAAATVHMLRIFFTGAFRKPREINWLIGLGLFMLAMVEGFAGYSLP
DDLLSGTGLRFADGLMRAIPLVGTWVEFFVFNGEFPGTAIVPRLYMVHILLIPALLLGLV
AAHLALVVYHKHTQYPGPGRTEKNVVGYPLFPVYAAKAGGFFFVVFGVLTLMGTFLQINP
VWKFGPYNPGEVTAGSQPDWYMGWLEGAVRITPNWEWHIGHTTWSWNIFLPGVCLMGVLF
TLLVAWPFVEKWITGDESEHHLLDRPRNVPTRTALGVAAMSCYAMFWLSGANDIIATHFH
LSLNSITYFMRGAIFVVPIITYQITKRICVALQRADRQRLLLGSPSGEIIREPNGAFHEA
HVPVSDNEAWTLTQQKTYPILTAGSIDDRGRKVSKKRARWMKWFLGDNVPTVTREELEAA
RCHAEIGSGDSAPQAEIAD
Download sequence
Identical sequences A0A1N4Z5J3 D4HCN5
WP_002525072.1.102089 WP_002525072.1.17579 WP_002525072.1.22959 WP_002525072.1.2563 WP_002525072.1.26091 WP_002525072.1.26956 WP_002525072.1.3428 WP_002525072.1.43585 WP_002525072.1.43983 WP_002525072.1.45324 WP_002525072.1.48202 WP_002525072.1.50101 WP_002525072.1.5458 WP_002525072.1.59982 WP_002525072.1.61734 WP_002525072.1.72191 WP_002525072.1.81478 WP_002525072.1.82350 WP_002525072.1.89010 WP_002525072.1.90935 WP_002525072.1.94227 WP_002525072.1.98061 gi|295130286|ref|YP_003580949.1| gi|365964666|ref|YP_004946231.1| gi|407935091|ref|YP_006850733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]