SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295130503|ref|YP_003581166.1| from Propionibacterium acnes SK137

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|295130503|ref|YP_003581166.1|
Domain Number - Region: 195-218
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0549
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295130503|ref|YP_003581166.1|
Sequence length 221
Comment hypothetical protein HMPREF0675_3999 [Propionibacterium acnes SK137]
Sequence
MDSFVALLGSVWYLVLVAAISPVMILNANAAVHGQKQNHGWVFVSGAGLVLGAIGVTSFG
LLGSAATDFASRQLASRTVDRVLGVLLFLFSCYLARTKWVSHRVQKSRVKKTSGPRSAGA
HGMFTWGALGMATNFTTIPLFISSSQRIGTADLPLVVRILTLIISWWIVLIPAWLPVVID
RLRPNSSGISGRTRERISHWTSVASIIACLGSGIIIVWTTL
Download sequence
Identical sequences D4HDA2
gi|295130503|ref|YP_003581166.1| WP_013069425.1.82350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]