SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262200065|ref|YP_003271273.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262200065|ref|YP_003271273.1|
Domain Number 1 Region: 76-253
Classification Level Classification E-value
Superfamily Rhomboid-like 1.14e-41
Family Rhomboid-like 0.0011
Further Details:      
 
Domain Number 2 Region: 3-49
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000595
Family B-box zinc-binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262200065|ref|YP_003271273.1|
Sequence length 303
Comment rhomboid family protein [Gordonia bronchialis DSM 43247]
Sequence
MTMPPYTPPQAAVCYRHPDRPTGLSCSRCGRSACPECLRPAAVGQHCVDCLRNDGIQQST
ATTPRRRWSSAVAGDTPYVTYALIVINLIVFGLCVAEAGITNPGNAALMSDGSLVKGIVG
EGEYWRLLTAGFLHFSVMHVAVNMISLYIIGRDLERALGTYRYLAVYLISLLGGSAAVML
FEADNVQTAGASGAIYGLIGAMLVIVLKARVPATPVLVIIGFNVVLSVSLPGISLMAHLG
GLAFGVAATAAIVYLPGLVLPRARLDAASANRVAWAALVTLLVVALGLGVGAGMLYDGPT
ILR
Download sequence
Identical sequences D0LA51
WP_012831972.1.40537 526226.Gbro_0021 gi|262200065|ref|YP_003271273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]