SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262202340|ref|YP_003273548.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262202340|ref|YP_003273548.1|
Domain Number 1 Region: 78-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000994
Family NfeD domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262202340|ref|YP_003273548.1|
Sequence length 141
Comment hypothetical protein Gbro_2413 [Gordonia bronchialis DSM 43247]
Sequence
MSALLWLAAAILLVIAEMFGGELFLLMLAGGAVGAAGAALLGAPVWLEVVVFALISVLLL
VGVRPVAKRHMLSRPRVLTNTEALEGRHAIVTEQVDDHDGRVKIDGDVWSARSMNPGEVI
AAGEQVMVVQIDGATAVVWRG
Download sequence
Identical sequences D0LDN2
526226.Gbro_2413 gi|262202340|ref|YP_003273548.1| WP_012834210.1.40537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]