SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262203769|ref|YP_003274977.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262203769|ref|YP_003274977.1|
Domain Number 1 Region: 440-549
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262203769|ref|YP_003274977.1|
Sequence length 557
Comment sulfate transporter [Gordonia bronchialis DSM 43247]
Sequence
MTGMTAATAVRQARTRLTRLLPAAADYRDLRSSWKGDVLAGVTVGVVALPLALAFGISSG
VGAAAGLITAVIAGLVAAVFGGSHVQVSGPTGAMAVILAPIVAAHGLGSIALVTVLAGLI
VLVAGAVGLGRAVTFIPWPVIEGFTLGIAVIIFLQQVPAAFGTTTPAGERTLPAAVDVVI
HADWPVALRTLGVVALVAVLMVGLPRIHRGIPESLTAVVVATVAVLVLHVDVARIGELPS
HLPAPVLPHVDPSALSSLLGAALAIAALAAIESLLSARVAATMSPTGPYDPDRELTGQGL
ASVASGMFGGMPATGAIARTAVNVRSGARTRVSAIVHALFLLGVVYLATGPVAEIPLAAL
SGVLMVTCFRMISASTIRKIVRSTRSDAVIFVVTAVITVTFDLIEAVQIGIVVAAFFALR
QVAKRSSVTREPIPGPPRRGDEQIALLRLDGAMFFGAAERISSTISAGAGNSTVTVVVIR
MSHLGMLDATGAHTLAEIVADLEARGITVIIKGVQPEHRRLLDGVGVFDSLRHERHLMDT
LDEAIEHARDHVARVEH
Download sequence
Identical sequences D0L3T1
gi|262203769|ref|YP_003274977.1| WP_012835587.1.40537 526226.Gbro_3908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]