SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262204123|ref|YP_003275331.1| from Gordonia bronchialis DSM 43247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262204123|ref|YP_003275331.1|
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262204123|ref|YP_003275331.1|
Sequence length 107
Comment sulfate transporter/antisigma-factor antagonist STAS [Gordonia bronchialis DSM 43247]
Sequence
MTASKPYCLQRFSGEIDMRNTIDFAAVLDRILVEPHDRIVIDMTCVDFAGTSALTVLTQF
CAAATESSTRVVVACGRAVARPIEACGLGPIETYDSVDAAIRAISTP
Download sequence
Identical sequences D0L5V2
gi|262204123|ref|YP_003275331.1| 526226.Gbro_4293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]