SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292899374|ref|YP_003538743.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292899374|ref|YP_003538743.1|
Domain Number 1 Region: 88-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.49e-29
Family Phosphate binding protein-like 0.0064
Further Details:      
 
Domain Number 2 Region: 5-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.81e-18
Family LysR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292899374|ref|YP_003538743.1|
Sequence length 310
Comment LysR family transcriptional regulator [Erwinia amylovora ATCC 49946]
Sequence
MWSEHSLEVIDAVARTGSFTAAAAELHRVPSAISYTVRQLEEWLAVNLFERRHRDVVLTD
AGRVFSEEGRIVIKKMLATRRRCQQVANGWRGQLNIAVDRIVRPSRTRQLVVDFYRHFPD
MELHIMPEVFNGVWDALADGRVDVAIGATQAIPVGGRFAFRDMGSLNWRCVVNAQHPLVS
RPGPLTEEWIREWPSLVLEDTSRALPKRTTWTLDNQRRLVVPDWESAFDCLRAGLCVGMV
PGHFAQPLLQRNELRELALSSHFPDSPCCLSWSEQSASPALSWLLEYLGSTETLRAEWLS
EQQDPAPLRD
Download sequence
Identical sequences D4I2D2
WP_004157422.1.11283 WP_004157422.1.1383 WP_004157422.1.23240 WP_004157422.1.33884 WP_004157422.1.35084 WP_004157422.1.36353 WP_004157422.1.46807 WP_004157422.1.47263 WP_004157422.1.6082 WP_004157422.1.61414 WP_004157422.1.71696 WP_004157422.1.76509 WP_004157422.1.91631 gi|292899374|ref|YP_003538743.1| gi|292488164|ref|YP_003531046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]