SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292899847|ref|YP_003539216.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292899847|ref|YP_003539216.1|
Domain Number 1 Region: 6-224
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.12e-67
Family Phosphate binding protein-like 0.00000000654
Further Details:      
 
Domain Number 2 Region: 226-298
Classification Level Classification E-value
Superfamily GlnB-like 2.45e-21
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292899847|ref|YP_003539216.1|
Sequence length 299
Comment ATP phosphoribosyltransferase [Erwinia amylovora ATCC 49946]
Sequence
MLDNTRLRIAMQKSGRLSDESRELLARCGIKINLQQQRLIAFAENMPIDILRVRDDDIPG
LVMDGVVDLGIIGENVLEEELLTRRAQGEDPRYQTLRRLDFGGCRLSLAMSVDDEYSGPQ
CLQNSRIATSYPHLLKKYLDEQRVSFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN
GLREVEVIYRSKACLIQRDGEMPANKQLLIDKLMTRIQGVIQARESKYIMLHAPGERLEE
IINLLPGAERPTVLPLAGDKSRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMME
Download sequence
Identical sequences D4HW71 E5B6S4
gi|292488691|ref|YP_003531578.1| gi|292899847|ref|YP_003539216.1| WP_004158273.1.11283 WP_004158273.1.1383 WP_004158273.1.23240 WP_004158273.1.33884 WP_004158273.1.35084 WP_004158273.1.36353 WP_004158273.1.46807 WP_004158273.1.47263 WP_004158273.1.5400 WP_004158273.1.6082 WP_004158273.1.61414 WP_004158273.1.71696 WP_004158273.1.76509 WP_004158273.1.91631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]