SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292898567|ref|YP_003537936.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292898567|ref|YP_003537936.1|
Domain Number 1 Region: 33-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.05e-83
Family Phosphate binding protein-like 0.00000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292898567|ref|YP_003537936.1|
Sequence length 271
Comment D-methionine ABC transporter substrate-binding lipoprotein [Erwinia amylovora ATCC 49946]
Sequence
MSFNLKTFVAVGALIGTLALVGCDQKAKDPNHIKVGVIVGSEQQVAEVAAKVAKDKYGLD
VELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLVSVGNTFVYPIAGYSKK
IKSLDQLQNGAQVAIPNDPTNLGRTLLLLQKVGLIKLKDGVGLLPTSLDVVENPKNLKLV
ELEAPQLPRSLDDQQIALAVINTTYASQINLTPAKDGIFVEDKNSPYVNLIVAREDNKDA
ENVKKFVQAYQSDEVNDAANKVFNGGAVKGW
Download sequence
Identical sequences D4HZ52 E5B807
WP_004159403.1.11283 WP_004159403.1.1383 WP_004159403.1.23240 WP_004159403.1.33884 WP_004159403.1.35084 WP_004159403.1.36353 WP_004159403.1.46807 WP_004159403.1.47263 WP_004159403.1.5400 WP_004159403.1.6082 WP_004159403.1.61414 WP_004159403.1.71696 WP_004159403.1.76509 WP_004159403.1.91631 gi|292489198|ref|YP_003532085.1| gi|292898567|ref|YP_003537936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]