SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292898591|ref|YP_003537960.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292898591|ref|YP_003537960.1|
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.54e-53
Family Phosphate binding protein-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292898591|ref|YP_003537960.1|
Sequence length 261
Comment ABC transporter substrate-binding protein [Erwinia amylovora ATCC 49946]
Sequence
MKKGLSTLLAAALLFSQISVVQADQLQDVEKRGVLRVAVPQDFPPFGSVGTDLQPQGYDI
DMATYLAKQMKLKLQLVPVTSANRVPYLQTGKVDLVISSLGKNPEREKVIDFSRAYAPFF
LGVFGAKPGALKDAAGLSGKSVGVTRGAVEDMVLTSVAPKDAQVKRYEDNNTTLSAYLSG
QVQYVATGNLVVAAIARQQADKAPVAQFMLKDSPCFIGMKKGEPALKAKVDALIEQALKD
KTLNRLAERWLKAPLPADLGA
Download sequence
Identical sequences D4HXB9 E5B2K8
gi|292487346|ref|YP_003530218.1| gi|292898591|ref|YP_003537960.1| WP_004156069.1.11283 WP_004156069.1.1383 WP_004156069.1.23240 WP_004156069.1.33884 WP_004156069.1.35084 WP_004156069.1.36353 WP_004156069.1.46807 WP_004156069.1.47263 WP_004156069.1.6082 WP_004156069.1.61414 WP_004156069.1.71696 WP_004156069.1.76509 WP_004156069.1.91631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]