SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292898987|ref|YP_003538356.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292898987|ref|YP_003538356.1|
Domain Number 1 Region: 7-247
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.66e-74
Family Phosphate binding protein-like 0.00000000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292898987|ref|YP_003538356.1|
Sequence length 249
Comment glutamine ABC transporter substrate-binding protein [Erwinia amylovora ATCC 49946]
Sequence
MMKSIFKFSIAALALAFAFSSAAAEKKLVVATDTAFVPFEFKQGGQYVGFDIDLWDAIAK
QLNMEYTLKPMDFSGIIPALQTRNIDLALAGITITDERKKAIAFSDGYYKSGLLVMVKAN
NDAVKGIEDLNGKVVAVKSGTGSVDYAKQHIKYKDLRQFPNIDNAYMELGTNRADAVLHD
TPNILYFINTAGKGQFKAVGNSIEAQQYGIAFPKGSDDLREKVNGALKTLRDNGTYNTLY
KKWFGSEPE
Download sequence
Identical sequences D4HZN0
gi|292898987|ref|YP_003538356.1| gi|292487758|ref|YP_003530631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]