SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292899024|ref|YP_003538393.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292899024|ref|YP_003538393.1|
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.02e-65
Family Phosphate binding protein-like 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292899024|ref|YP_003538393.1|
Sequence length 243
Comment arginine ABC transporter substrate-binding protein [Erwinia amylovora ATCC 49946]
Sequence
MKKIVLAALLASVTFAPQAAEKIRFASSATYPPFESLNGENQIVGFDIDLANALCAQMKA
ECSFSNNPFDSLVPALKFRRYDAVISGMDITAERSKQVSFTRPYYANSAIIIAQKGKFTA
ISQLKGRRVGVENGTTHQRYLQEKHPEIVTVAYDSYQNAILDLKNSRLDGILGDSAVVGA
WLKTNANLASVGEHITDSDFFGTGIGIAVRKDNQALLDQFNAAIDVLKANGTIDRLDQRW
FAR
Download sequence
Identical sequences D4I054 E5B3W7
gi|292899024|ref|YP_003538393.1| gi|292487794|ref|YP_003530669.1| WP_004156864.1.11283 WP_004156864.1.1383 WP_004156864.1.23240 WP_004156864.1.33884 WP_004156864.1.35084 WP_004156864.1.36353 WP_004156864.1.46807 WP_004156864.1.47263 WP_004156864.1.6082 WP_004156864.1.61414 WP_004156864.1.71696 WP_004156864.1.76509 WP_004156864.1.91631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]