SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292900709|ref|YP_003540078.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292900709|ref|YP_003540078.1|
Domain Number 1 Region: 29-267
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1e-72
Family Phosphate binding protein-like 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292900709|ref|YP_003540078.1|
Sequence length 267
Comment lipoprotein-28 [Erwinia amylovora ATCC 49946]
Sequence
MDRALIAALLLLGSLLTGCDNKNQDARHIKVGVINGAEQDVAEVAKKVAKEQYGLNVELV
GFSGSLLPNEPTAHGDLDANVFQHRPFLEQDNKASGRTLVAVGNTFVFPIAGYSKKIKRI
SELKDGDTVAIPNDPTNLGRALLLLQKEKLVTLKPNSGLLPTALDVTANPRHLKMIETEA
AQLPRVIDDAQVTVAIINTTYIQQTGLNPVRDSLFIEDKQSPYVNIIVTRANNKDAAKVR
DFIRAYQSPEVAAAADKIFNGGAVVGW
Download sequence
Identical sequences D4HV77
WP_004155196.1.11283 WP_004155196.1.1383 WP_004155196.1.23240 WP_004155196.1.33884 WP_004155196.1.35084 WP_004155196.1.36353 WP_004155196.1.46807 WP_004155196.1.47263 WP_004155196.1.6082 WP_004155196.1.61414 WP_004155196.1.71696 WP_004155196.1.76509 WP_004155196.1.91631 gi|292900709|ref|YP_003540078.1| gi|292486896|ref|YP_003529766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]