SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292900844|ref|YP_003540213.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292900844|ref|YP_003540213.1|
Domain Number 1 Region: 27-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-49
Family Phosphate binding protein-like 0.00042
Further Details:      
 
Weak hits

Sequence:  gi|292900844|ref|YP_003540213.1|
Domain Number - Region: 273-317
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 0.044
Family 5' to 3' exonuclease, C-terminal subdomain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292900844|ref|YP_003540213.1|
Sequence length 341
Comment ABC transporter substrate-binding protein [Erwinia amylovora ATCC 49946]
Sequence
MKKMMLSTLVTAAALFTLANQAHAGTTLDAIKKKGFIQCGISDGLPGFSYADANGKFSGI
DVDVCRAAAAAVLGDAGKVKYTPLTAKERFTALQSGEVDILSRNTTWTSARDGGMGFIFA
GVNYYDGIGFLTHQKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRS
DESAKALDSGRCDTLASDQSQLYALRIKLGKPDDFIVLPEVISKEPLGPVVRRDDDDWFT
IVKWSLYAMLNAEEMGITSKNVDSMSAKPSNPDMAHLLGAEGDYGKDLKLGNKWAYNIIK
QVGNYQEVFDRNVGKDSQLKIVRGQNALWNNGGIQYAPPVR
Download sequence
Identical sequences D4HUT5 E5B0T1
WP_004155024.1.11283 WP_004155024.1.1383 WP_004155024.1.23240 WP_004155024.1.33884 WP_004155024.1.35084 WP_004155024.1.36353 WP_004155024.1.46807 WP_004155024.1.47263 WP_004155024.1.6082 WP_004155024.1.61414 WP_004155024.1.71696 WP_004155024.1.76509 WP_004155024.1.91631 gi|292486754|ref|YP_003529624.1| gi|292900844|ref|YP_003540213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]