SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292900964|ref|YP_003540333.1| from Erwinia amylovora ATCC 49946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292900964|ref|YP_003540333.1|
Domain Number 1 Region: 230-621
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.63e-110
Family Amylase, catalytic domain 0.00000000000264
Further Details:      
 
Domain Number 2 Region: 623-726
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.8e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00000563
Further Details:      
 
Domain Number 3 Region: 117-222
Classification Level Classification E-value
Superfamily E set domains 1.75e-33
Family E-set domains of sugar-utilizing enzymes 0.0000032
Further Details:      
 
Domain Number 4 Region: 16-115
Classification Level Classification E-value
Superfamily E set domains 1.08e-17
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292900964|ref|YP_003540333.1|
Sequence length 728
Comment 1,4-alpha-glucan branching protein [Erwinia amylovora ATCC 49946]
Sequence
MSELVDRRVINAVVSGHFADPFSLLGMHQTRLGLEVRALLPDASEVWVIETASGNKCVQL
KCLDARGFFHAVIPGRKKPFRYQLAVTWHGQQNLIDDAYRFGPLLPEMDGWLLAEGTHLR
PYETLGAHGDVIDGVSGTRFAVWAPNAQRVSVVGEFNYWDGRRHPMRLRREMGIWELFIP
GARNGQLYKFEMIDIHGQLRLKADPYAFEAQMRPQSASMICGIPEKTTLSPQRQRANGFD
APISIYEVHLGSWRRHTDNHFWLSYQELAQQLVPYAKEMGFTHLELMPVNEHPFDGSWGY
QPLGMYAPTRRFGTRDDFRAFITAAHQAGLNVLLDWVPGHFPTDDFGLAKFDGSELYEHG
DPREGFHQDWNTLIYNFGRREVSNYLAGNALYWIERFGIDGLRVDAVASMIYRDYSRAEG
EWVPNHFGGRENLEAIAFLRYTNRTLGHAAPGAITIAEESTDFNGVSRPPETGGLGFWFK
WDLGWMHDTLDYLKLDPIYRRHHHNLMTFGMLYSNTENFVLPLSHDEVVHGKGSILDRMP
GDAWQKFANMRAYYGWMFGFPGKKLLFMGNEFAQGKEWNHDTSLDWHLLEGEDGWHNGVQ
RLVRDLNHTYRAHPPLYQQDFDPAGFEWLVVDDFENSVFVFVRRDSDGNELIVASNFTPV
PRHDYRFGVSQAGRWREVLNTDSSHYHGSNIGNLGVVSTHDWGSHNRSHSLSLTLPPLST
LWLVREAE
Download sequence
Identical sequences D4I3J7
gi|292900964|ref|YP_003540333.1| WP_004160766.1.11283 WP_004160766.1.1383 WP_004160766.1.23240 WP_004160766.1.33884 WP_004160766.1.35084 WP_004160766.1.36353 WP_004160766.1.46807 WP_004160766.1.47263 WP_004160766.1.6082 WP_004160766.1.61414 WP_004160766.1.71696 WP_004160766.1.76509 WP_004160766.1.91631 gi|292489930|ref|YP_003532822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]