SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260752512|ref|YP_003225405.1| from Zymomonas mobilis subsp. mobilis NCIMB 11163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260752512|ref|YP_003225405.1|
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily Nudix 2.57e-30
Family MutT-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260752512|ref|YP_003225405.1|
Sequence length 184
Comment NUDIX hydrolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
Sequence
MPHNSKSTSQPETEILYSGKFIILKRRGTWEYASRPHNMGAAVILALDGEYVILVEQPRI
PFGAHTIELPAGLIGDTDSHESVETAAARELIEETGYQADIIENLGQFASSPGMTSESFF
LVRAKNLTRISEGGGVDDEEITVHRVKLSELPDFLEQKRQQGLVIDAKLLLLLGSNFLGL
SVSK
Download sequence
Identical sequences WP_012817000.1.88046 gi|260752512|ref|YP_003225405.1| 622759.Za10_0269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]