SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|260752669|ref|YP_003225562.1| from Zymomonas mobilis subsp. mobilis NCIMB 11163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260752669|ref|YP_003225562.1|
Domain Number 1 Region: 12-155
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.41e-37
Family Cytidine deaminase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260752669|ref|YP_003225562.1|
Sequence length 161
Comment cytidine deaminase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
Sequence
MSESIDAFEAGNITVKSLMDKARTAARQSYSPYSAFAVGAALLLKDGSVITGTNFENASY
GLTLCAETVAVATANTVGHLAHIRAIAICGGKFDEGRFIGHDIIYPCGRCRQVLNEAAEI
GHYDIMVYCGSAEGSEIEPHRLSTLLPHSFGPKNLTSPKND
Download sequence
Identical sequences gi|560136362|ref|YP_008832991.1| WP_012817107.1.26972 WP_012817107.1.41889 WP_012817107.1.67824 WP_012817107.1.88046 gi|260752669|ref|YP_003225562.1| 622759.Za10_0428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]