SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260753873|ref|YP_003226766.1| from Zymomonas mobilis subsp. mobilis NCIMB 11163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260753873|ref|YP_003226766.1|
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily Nudix 4.06e-28
Family MutT-like 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260753873|ref|YP_003226766.1|
Sequence length 155
Comment NUDIX hydrolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
Sequence
MDNLEYRSGVGIMLLNKDNLVFAACRNDMKEEAWQMPQGGLEAKETPEVGVLRELEEETG
IPPRMVAIISHTKEWLTYDFPADLQASFFKNKYRGQRQLWFLARYLGRDEDININTDKPE
FRAWKWVEPKQLPDLIVAFKKPLYEKILSEFSASL
Download sequence
Identical sequences A0A0H3G031 Q9RH11
WP_011241323.1.26972 WP_011241323.1.32473 WP_011241323.1.33991 WP_011241323.1.34904 WP_011241323.1.41889 WP_011241323.1.4952 WP_011241323.1.67824 WP_011241323.1.74559 WP_011241323.1.88046 gi|560137468|ref|YP_008834097.1| 264203.ZMO1562 622759.Za10_1646 gi|56552458|ref|YP_163297.1| gi|384412472|ref|YP_005621837.1| gi|260753873|ref|YP_003226766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]