SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294502105|ref|YP_003566170.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294502105|ref|YP_003566170.1|
Domain Number 1 Region: 30-266
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.13e-81
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 273-390
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.16e-22
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294502105|ref|YP_003566170.1|
Sequence length 393
Comment DNA polymerase IV, damage-inducible protein P [Salinibacter ruber M8]
Sequence
MSRPEDADKAETKADKSGTGRAAGSPGREEEAARRILHVDMDAFYASIEQRDFPDKYAGE
PIAVGGDPPTGVVKAASYEARPYGVHSAQPAVEADRQCPGLIFVPPRMEVYQEESRRIRE
ILRRYTDVIEPLSLDEAYLDVTEPKKGPPSGTLVARRIREEIYQETGLTASAGVGPSKFV
AKVASDRDKPDGLTVIRPEEQLDFIAGLPVGDFHGIGPVTEEKMQEMGIESGAGLQDTPE
KALRRRFGKRGGHFKKLAMGEDDRPVQPDRESKSVGAERTFSEDISEPKEMLSRLEPIAE
RVAGRLGSAGPEGTPVRGRTVTLKLKSHDHEVSTRQTTLRRAIRSEEALMRLAKWLLSRP
HPPEEPVRLLGLSVSSLTGREEGKQLELDFGRG
Download sequence
Identical sequences D5H4B4
gi|294502105|ref|YP_003566170.1| WP_013060247.1.91540 gi|294502105|ref|YP_003566170.1|NC_014028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]