SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294505907|ref|YP_003569965.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294505907|ref|YP_003569965.1|
Domain Number 1 Region: 790-1007
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.37e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.00038
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.89e-34
Family Multidrug efflux transporter AcrB transmembrane domain 0.00049
Further Details:      
 
Domain Number 3 Region: 136-182,269-321
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.71e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0037
Further Details:      
 
Domain Number 4 Region: 40-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.46e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0072
Further Details:      
 
Domain Number 5 Region: 185-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000955
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0059
Further Details:      
 
Domain Number 6 Region: 711-787
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000353
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.015
Further Details:      
 
Domain Number 7 Region: 555-654
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000209
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294505907|ref|YP_003569965.1|
Sequence length 1016
Comment cation/multidrug efflux pump AcrB [Salinibacter ruber M8]
Sequence
MDIAKAAIENRTLTYVTTLLVVVGGVIAFLNLGRLEDPEFTIKRALVVTQYPGATAHEVE
AEVSDPIEEAVQAMGKVKEIKSRSSRGRSTLEVEMKSDVIGDAVTQAFDDLRDKVNDAQG
RLPPGAGPSVVEDDFGDVYGIFMAITGEGYSKQELKDHAEALKRELVQVQGVAKVRLFAD
RQETIYVEPNRDRLSNLGISVDRIAGRLRTQNTVVDAGRVRVGDSHISVRPSGATASLDD
LRSILIASQGGRQIFLEDIATVRRGYAAPPRALMRYDGEPAIGLGVSTVDGGNVVTMGRA
VKARLDELKADRPVGIEYNYINFQAEDVSEAVSGFVWNLVTAIAIVIVVLLLAMGWRSGL
LMGFVLAVTVLGTFILMYATDVVLQRISLGALIIALGMLVDNAVVIVDGILTRLKEGRER
VEAASEIVEQTKWPLFGATAVAILGFAAIGTSSDSSGEFLGSLFLVILYSLSLSWVLSVT
LAPLLGVDFLKKPDPDEAVESAHDGPVYTVYRRLLQGAINYRWVTVAVITVLMGLSIWGS
GFVKQSFFPDSTRPQFLVDVWMPQGTHIRDTEDAVKEAEQYVQGLDAVTHVSSVVGQGAL
RFVLPYSPERPNSSYAQLIVDVDDWRTISSLKDSVDARLSAMLPRANVYAFPFVFGPGGG
TGRIQARISGPNPDSLRAIAQRVEGIFRAHDNTKAVRNDWRNRVEVTRPQVAEDAASALG
VTRPDVARAVQRTFEGTRMGVYRRGEDLLPIMMRAPSEERARASNMKNAQVWSPVAGAYV
PIRQVVSGFETGFEDGIVWRYKRAPTVSVYADPISGTATSVFQQVRPTVEKLSLPRGYDI
EWGGQYENSNEANASLFSAVPIFFVLMVLITVALFNALRQPLIIWLTVPLALIGVVAGLL
ATGAAFGFTALLGFLSLSGLLIKNAVVVIDEIEIWKQDESLYQAIVGASVVRLRPVMMAS
ITTALGMIPLFTDAFFVAMAVTITSGLLFATVLTMIVVPVLYAILFGVERLPYSER
Download sequence
Identical sequences D5H4Q8
gi|294505907|ref|YP_003569965.1| WP_013060590.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]