SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506196|ref|YP_003570254.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506196|ref|YP_003570254.1|
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-56
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.00025
Further Details:      
 
Weak hits

Sequence:  gi|294506196|ref|YP_003570254.1|
Domain Number - Region: 247-348
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00612
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294506196|ref|YP_003570254.1|
Sequence length 426
Comment protein umuC [Salinibacter ruber M8]
Sequence
MDSVIALIDCQAFYVSCERVFDPALRGRPTVVLSNNDGCIIARSAAVKAAGVPMGAPVFK
WRDELEAMDAAVLSSNYALYADLSRRVTAVLETMSIDLERYSIDECFVTLPALDRDALRA
LGERIRCRVRDWVGIPVRVAIGPTKSLSKIADEKAKADKRAGDGTGVYVCPPEPDLDVLL
YRTDVGDVWGIGPSYEETLREHGVTTAAEFRALPDPWIRSTMTVVGLRLARELRGQRCLD
LDLVGPDRQSLVRSRSFDAPVEAKAELRQALAKHAQRAAEKLREEDLVARGISAFITTKT
HGPPPHYADEAQATLDEHTAAAPPFVRSSRRLLDAIYRAGPAYRKAGVMLYAIRPRRPHQ
GSLFGRPVQDDEALMQAVDRINGTMGRGTIGVAAAGLPGDRDWTMTRDNTSQHYTTRWDE
LPVARA
Download sequence
Identical sequences D5H5J7
WP_013060866.1.91540 gi|294506196|ref|YP_003570254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]