SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506224|ref|YP_003570282.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506224|ref|YP_003570282.1|
Domain Number 1 Region: 812-1037
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.89e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.00073
Further Details:      
 
Domain Number 2 Region: 290-485
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.89e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.00026
Further Details:      
 
Domain Number 3 Region: 42-131
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.1e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0028
Further Details:      
 
Domain Number 4 Region: 181-263
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000222
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0063
Further Details:      
 
Domain Number 5 Region: 738-814
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000445
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.005
Further Details:      
 
Domain Number 6 Region: 141-178,266-321
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000314
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294506224|ref|YP_003570282.1|
Sequence length 1047
Comment Cobalt-zinc-cadmium resistance protein czcA [Salinibacter ruber M8]
Sequence
MNRAIDWFARHGVAANLLTMLLLVGGVVAGGLVVQENFPEFSLDAVEVRVRYPGASPEDV
EDDIVRRVEDRIEGVEGIDRLLGTAADNIGVVTAELKRGTNLDRARTDIKSEVDRVTSFP
ENAEEPVVTEVTNREQVLQVALHGEASLRALKNAAQRAEGDLTRTPQVSYAEVSGVPDEE
ISIEVSRGALRAHGLTLAQVSRIVREGSLDLPAGSIETEDSDITIRTEGQNYTKSDFEDI
VLLSRNDGTNVLLGDVATVVDGFEQNSDLRTRFDGDPAVLLNVFRTGDEQALSVEEAVKT
YLSETLRPTLPRGIEATVWRNSAESLRTRLTIMVENGVLGLVLVLVVLTLFLAPRKAFWT
ASGILLSFVGALIFMQQFGVSINMLSVFGFIIAMGIAVDDAIVVVENVYAEQERTGAPLT
AAVEGTQRVATPVVFAVLTTIAAFAPLLFVGGTIGKFLGDIPTVVIFVLIVSVVEVLFVL
PAHLSHGTGDDGPSTAVGQWLDGIRAGVHDRLVAFVHGPLTTLLRFATRRYGVTLVGGLS
LLVVTFSLVANGYVKNEFFPSIPGNVVTAQLEMPPGTNADETARRAERLRAQGLGVLRDL
EKEADERLLENTYTTVSRQPVASGGRTQAGFTAPRPNVAEVSIEMVDAEARSVPSPVLEE
QWRDTVGTPAGVQSLAFTSTAGGPGGDPVSVQLFAPTVDAMTRAADVVQDTLRRYAGVQD
VTVDWEEKRELSLRMKPAARSLGLTLSDVARQVRAAFFGTESFRLQRGEDEVRVYVRLPA
AQRSAVADLSDYRIRAPGGAEVPLEEVATVSLGYSPTQIDRQDGRRVVTVSADVNPAVTT
GGATTARLERATLPALQAQVPTLSYQFGGQQREQRKAQGSLQIGFLLALFAIYGLLAIPF
RSYVQPLIIMSTIPFAWIGALFGHFLLGYNLILPSIFGIIGLSGVIVNDALVMLDFANEE
RGEGATWRDALVRAGQVRFRPILLTSLTTFFGLAPFILERSVEAQFLVPMAISLGGGILV
GTAVLMLIVPALAMLQRDVVAGLRSLF
Download sequence
Identical sequences D5H5M5
gi|294506224|ref|YP_003570282.1| WP_013060886.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]