SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506289|ref|YP_003570347.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506289|ref|YP_003570347.1|
Domain Number 1 Region: 26-247
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 9.81e-80
Family Nqo1 FMN-binding domain-like 0.000000227
Further Details:      
 
Domain Number 2 Region: 340-436
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 2.88e-32
Family Nqo1C-terminal domain-like 0.0003
Further Details:      
 
Domain Number 3 Region: 255-338
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 2.22e-17
Family Nqo1 middle domain-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294506289|ref|YP_003570347.1|
Sequence length 453
Comment NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit [Salinibacter ruber M8]
Sequence
METNGTPQSPAGDWRSYERMLLPPIQDLHKLGVYEEHGGYDRLRRVLEDDAFEPSDVTDE
VKASGLTGRGGAGFPTGIKWTFMPEPDERPRFIGVNADESEPGTFKDRQVMEYNPHLMLE
GILLAGYALHIDTAYVYIRGEYTDWIVHLKEQLENAYEAGYVGENIMGSDFTMDIVLHKG
AGAYICGEETSLMESLEGKRGYPRYKPPFPAQSGIFGSPTTINNAETLAHVPLIVEQGGE
AYSNIGAGDMPGPALYGMSGHVKNPGVYEFPTGMLLTDMIYDVCGGMARDKDLKAVVPGG
SSVPPVPADQIDGISMNDESLGEVGSRTGTFCPLVLDEETDMVSFLRRVAHFYQDETCGQ
CTPCREGTSWLEKILARIDEGEGRMRDIDLLLELCDNMDGGRTICAFADGAVGPVRATVK
RFREEFVAKCQASVHPVSTEVSAGAESAVAATE
Download sequence
Identical sequences D5H5U0
gi|294506289|ref|YP_003570347.1| WP_013060938.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]