SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506333|ref|YP_003570391.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506333|ref|YP_003570391.1|
Domain Number 1 Region: 11-364
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.28e-20
Family UDPGT-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294506333|ref|YP_003570391.1|
Sequence length 393
Comment glycosyl transferase family protein [Salinibacter ruber M8]
Sequence
MSHPPRTGDAMALRCLFVVQGEGRGHLTQAMALRRMLRDAGHRVAGVVVGKSDDQAVPAF
FRAAFEAPVTDVESPGFVSDDADRSVRPWATLRRALGRTPTYWRSLSALDAAIKRHDPDV
VVNFFEPLMGLYAVTHSPSVPVVAVAHQYMFLHPAYRFPSGRRDKRWAARAFARLTACGA
SRRLALSLYPAPDRSQDDLAVLPPLLRPGVFRQPQDRSEPFILVYILNSGYADEVIRWHE
QNPTVPLHCFWDRPDAAPVEAYDETLTFHQLDDEKFLRLMARCRGFVSTAGFESIAEAMY
LGTPVQVVPVEGHYEQRCNAVDAVRAGAGVRSTQFDIGHLRAALDRGSTPEARFQAWVRQ
GRRRFVRELEAAARRPVAGSLGPRVAERILEAA
Download sequence
Identical sequences D5H5Y4 Q2S5E6
309807.SRU_0440 gi|294506333|ref|YP_003570391.1| gi|83815709|ref|YP_444585.1| WP_011403218.1.91540 YP_444585.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]