SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506368|ref|YP_003570426.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506368|ref|YP_003570426.1|
Domain Number 1 Region: 814-1039
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.62e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.00048
Further Details:      
 
Domain Number 2 Region: 292-484
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.06e-37
Family Multidrug efflux transporter AcrB transmembrane domain 0.00031
Further Details:      
 
Domain Number 3 Region: 42-131
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.07e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0027
Further Details:      
 
Domain Number 4 Region: 740-815
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000471
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.005
Further Details:      
 
Domain Number 5 Region: 179-262
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000209
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0069
Further Details:      
 
Domain Number 6 Region: 139-178,266-322
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000000034
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|294506368|ref|YP_003570426.1|
Domain Number - Region: 569-680
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00167
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294506368|ref|YP_003570426.1|
Sequence length 1071
Comment AcrB/AcrD/AcrF family multidrug efflux transporter [Salinibacter ruber M8]
Sequence
MNRAIDWFARNGVAANLLMLLLLLGGGAAAFTTVQEVFPEFSLDSVQIQVTYPGGSPEEV
EQSIVRRIEDRIEGVEGIDRILGTATENSGVVTAELKRGTDLSRARTDIKSEVDRITAFP
EEAEQPIVTEVTNRQQALQIALYGDASERTLKELAQRVKDDLTRNPQISFVRIGGVRDYE
ISVEASREALRKYGMRLAEVSRIVREGSLDLPGGSVETDEEEIVIRTEGQNYTKEDFEDI
VALTRDDGTKVRLGEVASIQDGFAENSDLITRFNGEPAAILNVFRTGQEQVLDIEETVKT
YLDDDLQASLPAGVQAAIWQNQAESLRSRLNLLIENGILGLFLVVLTLTLFLAPRLAFWT
SVGIFLSFTGTFILMQYLDVSINLLSLFGFILSIGIVVDDAIVVGENVYAEQEGTGDPLE
ASIRGTQRVGIPVIFAVLTTVAAFSPLLFIGGTIGKFLGDIPTIVIIVLLLSLVEVLLIL
PYHLSERPDQEPGTPTLPIRTLNRVRRWVAAQLWAFVRGPLTTALRFATRHYGVTLVAGV
SLLFISFSFASNGYIGFSFFPSVQGKLVTAQLEMPVGTTPEATERMTARLQETGYEAIEA
LEAKAGQDLVENVYVAVGRQPQANSDPGAGGFTATQANVAEVSFEMIDPEERDITSAQFE
ERWRAETGRVPSARSLSFTANVVSVGKPVSVELSAPTPDKLDRTVAAVQDSLARFGGVFD
IKSDQEQGKRELELSMKPGARTLGLSLNDLAGQVRAAFFGLESYRLQRGQNEVRVYTRLP
DDQRNSIEDLSDYRIRTAAGAQVPLEEVADVSFGYSPSQINRQDGRRVVTVTADVDPGVT
TGNAVKASLQSSVLPNIQRAIPGATFTFGGQQRQQRKAQSALVIGFLLALFAIYALLAIP
FRSYLQPLVIMSTIPFGWIGALLGHLMLDIQLGLLSIYGIVGLSGVIVNDALVMLDFANE
ERAEGRDWPDALVRAGQMRFRPILLTSLTTFLGLFPIIVEQSVQAQFLIPMAVSLGVGIV
FGTAVLMMIVPSIAMFQDRAVGWVQTRLLGYDEPVKHFGPYEERHAGDPSA
Download sequence
Identical sequences D5H619 Q2S5B3
gi|294506368|ref|YP_003570426.1| WP_011403251.1.91540 YP_444618.1.20240 309807.SRU_0473 gi|83815443|ref|YP_444618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]