SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506406|ref|YP_003570464.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506406|ref|YP_003570464.1|
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.73e-44
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.0000991
Further Details:      
 
Domain Number 2 Region: 132-210
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 5.23e-21
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294506406|ref|YP_003570464.1|
Sequence length 231
Comment ribose 5-phosphate isomerase [Salinibacter ruber M8]
Sequence
MDRDTAKQAAAEAAVQLVRDGMCVGLGSGSTTAYALDFLGRRIQDEGLHVQGVPTSFATE
RRARTHGIPLTSLDDTPSLDLALDGADEVDDAFRLIKGGGGAHAREKVVAHQADRFVVLV
DPTKEVRRLGTQFPVPVEVLPMAATPVMNALDAAGATPTLRTADAKDGPVVTDQGLWIID
ARFPDGIENPDALNRRLCDRPGVLDHGLFLNMATDVLVGRPDESVDHRSAS
Download sequence
Identical sequences D5H657
WP_013061035.1.91540 gi|294506406|ref|YP_003570464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]