SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506471|ref|YP_003570529.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506471|ref|YP_003570529.1|
Domain Number 1 Region: 16-392
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.85e-61
Family Glycosyl transferases group 1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294506471|ref|YP_003570529.1|
Sequence length 414
Comment group 1 glycosyl transferase [Salinibacter ruber M8]
Sequence
MEIAYIVSQYPARSETFIAREVKELLVQGNRLLIAPLRWSDTGEGIRVEGADVLGLQWNP
LDWVLSLAWAAARRPRQVLQMGRDICTAPLFSGLWRRLLVLSLVSLALARELDDRSVDHL
RAHFLDSEAIAAFWVSCLLDIPFSVTVHTLSTRFPTPLLRHVAQATSFCAVSGNGTKRMM
KGMANRQNRVGLIRNGVSLPSTVRSRAFPLVAPVWRLLAVGRLVEKKGFDTLLDACALLR
DWGRPFRCDIIGDGPCRDRLTEHARRLRIERHVTFCGAQPNHEVYRALRQHDVLVAPCRL
ASDGDRDGLPTVLMEALSCGVPVVASAFAAIPELVTDGETGRLVPPNAPVALARTLRRLF
DQPRHAFRMGREGREQVRRRFRLEREVETLDARIRTPPRASTFRDFREQAYALD
Download sequence
Identical sequences D5H6C2
WP_013061095.1.91540 gi|294506471|ref|YP_003570529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]