SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506576|ref|YP_003570634.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294506576|ref|YP_003570634.1|
Domain Number - Region: 26-92
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0275
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294506576|ref|YP_003570634.1|
Sequence length 123
Comment hypothetical protein SRM_00761 [Salinibacter ruber M8]
Sequence
MGLIGRVTADREARIPLRVRLGEGTERDVDAVIDTGFNGVLGLPTRLIEELGFARVGRER
MLLANGEFHFARIYRAIVDLEDRACSVRAVEAGEPLAGMGLLWEHELCIQCIDGGQVDLE
RLS
Download sequence
Identical sequences D5H6M7
WP_013061196.1.91540 gi|294506576|ref|YP_003570634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]