SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506718|ref|YP_003570776.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506718|ref|YP_003570776.1|
Domain Number 1 Region: 795-1013
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.63e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 290-490
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.02e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000159
Further Details:      
 
Domain Number 3 Region: 40-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.59e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00078
Further Details:      
 
Domain Number 4 Region: 182-263
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 7.72e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0006
Further Details:      
 
Domain Number 5 Region: 709-793
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.49e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0015
Further Details:      
 
Domain Number 6 Region: 136-181,268-324
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.92e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.011
Further Details:      
 
Domain Number 7 Region: 554-657
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000000000785
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294506718|ref|YP_003570776.1|
Sequence length 1048
Comment multidrug resistance protein containing Acriflavin resistance domain [Salinibacter ruber M8]
Sequence
MSLYSLSIRRPVLSTVFALLIMIFGAVGFYFLGVREYPAVDPPIISVSTQYRGANADVID
SQITEPLEEQINGIDGIRTIESVSREGQSTVTVEFDLGADLERAANDVRDRVSRAQQQLP
PDAEPPSVSKSDASAPPIVFLNIESETRSLMELTEIADKRFKERLQTIEGVSRVDIWGEK
TYSMRLELDPQKLAAYDLTPLDVRQALDRSNVELPSGRIEGETIELTVRTKSRLETVEDF
NSLLLKQSPDGQTVRLEDVGKADIAPLNERTLLQRDNVPMVGVVLRPLPGANYIDIVDEF
YRRVDDIKAELPSDLELGIGFDNTEPIRDSISEVQQTIFIAFLLVVLIIFLFLRDWRSTI
IPLIVVPIALTGSFFVMYAMGFSINVLTLLALVLAIGLVVDDAIVVLENIYAKIEEGKDT
MVAGLEGTREIFFAVVATSVSLVIIFAPIIFMGGLTGQLFQEFGMVIAGAVAFSSFVALT
LTPMLSTRLLKQRDEKPWIYRKTEPVFESLTDAYRRSLEAFMEYRWAAFVIMAGCIVVIT
TFHFTLPQELAPLEDRSLVRMNATAREGATYDYMSGYVDKMYEALDETVPDEHQRSTISV
TSPGFGAASSVNSAFMFTRLVPPGERDVSQMQYADSLQAALGELEGARTFVSQEPTISVG
GGGGGLPVQYVLQTSSVENLREALPTFLERARQQEELGVVDVNLKFNKPELQVEIDRDRA
NNIGVSPLDVAQTLQLALAEQRVGYFVRDGEQRQILATVDEEDRDAPVDLTSLYVRSASG
EPVPLDNLVSVSEQATPPQIFRFNRYMSATVSARPAPGNTIEDGIEAMDRVADDVLGPAF
STTLTGQSRDFQETSNQLLYVFGLALVLIYLVLAAQFESFRDPLVILFTVPLALAGAMLF
LWYFNQTINIFSQIGMVMLIGLVAKNGILIVEFANQRKAAGLSIREAIEEAAAVRFRPIL
MTALSTILGVLPIALALGAGAQSRVPMGVAVIGGLLVGTVLSLYVIPATYTYLTSEDAGP
ALVGDGGAGGDGLPEEGMAPQQQGAPSG
Download sequence
Identical sequences D5H719
WP_013061330.1.91540 gi|294506718|ref|YP_003570776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]