SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506845|ref|YP_003570903.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506845|ref|YP_003570903.1|
Domain Number 1 Region: 9-333,360-465
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.86e-122
Family Amylase, catalytic domain 0.00000122
Further Details:      
 
Domain Number 2 Region: 476-552
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.64e-16
Family alpha-Amylases, C-terminal beta-sheet domain 0.013
Further Details:      
 
Domain Number 3 Region: 876-1113
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000139
Family APH phosphotransferases 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294506845|ref|YP_003570903.1|
Sequence length 1126
Comment trehalose synthase [Salinibacter ruber M8]
Sequence
MPDDFLDDPLWYKDAVIYELHVRSFYDSNNDGYGDFQGLREKLPYLESLGVNTLWLLPFL
ESPLRDDGYDTADYFKVLPIHGDLDDFRAFLDDAHARGMRVITELVLNHTSDQHPWFQEA
RDPDSDKHDWYVWSDTDERYDDVRVIFTDTEDSNWAWDPKAEKYYWHRFFSHQPDLNFDN
PEVREKMKEVMFFWLDMGVDGLRLDAVPYLFEREGTSSENLPETIAYVKELRAAVEERYG
PGKVLLAEANQWPEDTLPYFGEDAEGESTGVQMAFNFPVMPRLYMALRRENRRPVVEMLD
LTSGIPDDAQWALFLRNHDELTLEMVTDEERDYMYHEYGADDRFRINVGIRRRLTPLLGG
ERRRIELMNALLLSLKGSPIIYYGDEIGMGDDPFLGDRNGVRTPMQWSPDKNGGFSRAPH
HKLFMPPINRGKYSYEFVNVEDAEADPYSLLHFMRRLIALRQQHKNIFGRGSLELLPVEN
QSILAFLREYEGERILVVNNLSRFTQSVHIPAREDLQGLAPVELSGQSAFPPIEDDDYHL
TVGPHHFYWFKLVPKEDVQRDDTRRSGLQPLEDKNGRTRPVLPVAEGLQNVLVPTMAQRR
GPEQIEALLPEFINEQRWFGGKGEGIEGVEVEDAVRLQSDPVVYLSVLRVDLPEDTSFYT
LPLMAAPEPEASDILDEHPNATLAWLEVEDTEERRLVYDATVNPRFWATLFRWWQRGGTG
RSLKGLYTAEPSEAMGDAPPDDVRLLTGEQSNTSAIVNNDYFLKLYRRLEEGPNPEKELL
EHLTDIDFTFSPRLHGTLNFRRRHRQYTLGVLQEALAVDADAWSYTLSCTTTFLDRVKNS
PFPHEQAKNTGPSADGPHWTADRFSDATVPVWLEELAPELISFARTLGVRTAEMHHALAQ
AGGDEMRPVEAPTDAGAELGTRIRTEMEETRALLDRQPDRVSGHVPSDPAWSAARDRLAP
LDDVPGTHDRIRIHGDYHLGQLLRAEGDIYVLDFEGEPTRPLEERRRRKNALRDVAGMLR
SLEYAVLASWQDHADVDPDYEPWIDALLYWTETTFLDAYADTTGDAAFLPAAPARYSFLW
AFLLDKALYEVRYELNHRPDWAWLPLHGLHRLLAPRDATASDPLDA
Download sequence
Identical sequences D5H7E6
gi|294506845|ref|YP_003570903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]