SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506846|ref|YP_003570904.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506846|ref|YP_003570904.1|
Domain Number 1 Region: 196-568
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.96e-76
Family Amylase, catalytic domain 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|294506846|ref|YP_003570904.1|
Domain Number - Region: 573-650
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00171
Family alpha-Amylases, C-terminal beta-sheet domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294506846|ref|YP_003570904.1|
Sequence length 678
Comment glycosidase [Salinibacter ruber M8]
Sequence
MASSATSPPASPDPTMPKSWSRVVISSVAPAIDGGQWPIKRAVGEQVEVTAGVLVDSHDA
LAVELVVRHASEETEHVTRMPHVENDEYAGAFEVSAPGRYLYRVRAWINRFATWQDQFRR
RVEGGEPPSEIESELTAGASLLDEAAEHAPEDDREMLTAHIEAFENGNAEAALGDEIAEL
ARRHAPHHQQTSSATYEVLVDPERARTGAWYEFFPRSARDDDEHATLDEAAERLPRIQEM
GFDIVYLPPIHPIGETNRKGPDDAPEAGPDDPGSPWAIGGFLADGSKGGHKSVHPKLGGI
EAFDRFVETAHDLGLEVALDVAFQCSPDHPYVEEHPEWFYHRPDGSLRYAENPPKKYKDV
HPINFETEAWPALWTELKSVFEYWIDHGVTTFRVDNPHTKPFAFWQWCLRELREDTPELV
VLSEAFTRPKTMHHLAKLGFNNSYTYFTWRNTPDALEAYGEELFHTEAAEYFRPNFWPNT
PDILHDELVDGGRPAHKSRFVLAATMSSTYGVYGPPFEHVDTQQRDHKEEYARNEKYEIR
TWDWNDPTSLQPFMARVNRLRNENPALQQTRSIRFLDTQHPDLIAYSKAAGDNLIVVVVS
LDPHSECEGQLVLPIHDLGLPADEAFSAHDLLHDAHYTWQGTHHYLRLSPDRPAHIFRLE
PAGTSEQTHAAYDRLVHA
Download sequence
Identical sequences D5H7E7
gi|294506846|ref|YP_003570904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]