SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506847|ref|YP_003570905.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506847|ref|YP_003570905.1|
Domain Number 1 Region: 196-531,560-636
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.3e-128
Family Amylase, catalytic domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 60-207
Classification Level Classification E-value
Superfamily E set domains 5.32e-46
Family E-set domains of sugar-utilizing enzymes 0.0017
Further Details:      
 
Domain Number 3 Region: 648-761
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000105
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294506847|ref|YP_003570905.1|
Sequence length 764
Comment glycogen debranching protein GlgX [Salinibacter ruber M8]
Sequence
MQLWPVGLIVSEVCGLIFVVHVERCRLLCAFELSLCCMDASSPSSIDTSPQNRGDRHIQP
GKPYPRGATWDGIGVNFALHSAHADRVELLLFEDADDREPAVTFELPEHTGPIWHGYVTN
VRPGQLYGYRVYGPYDPANGHRFNPNKVLLDPYAKAIGRPLRWDDSLFGYDVDAEEDDRS
FNTQDSAPHAPLAAVVEETFAWGNDQSPEIPWQDTLIYETHVKGMTQKHPDVPERLRGTY
LGMASEPVLDHLKTLGVTTVQLLPVHAKLHRRELLRKGLREYWGYNTLSYFAPEPEYAAN
GPTSAVRDFKMMVRALHDAGLEVIIDVVYNHTCEGNQMGPTLSWRGVDNRTYYKLNPDDE
RYYMDYTGTGNTLDPGDSYVLQMIMDSLRYWVTEMHVDGFRFDLASALARELYDVDMLGS
FFKVVQQDPVLSQVKLIAEPWDVGPGGYQVGSFPWQWAEWNGRYRDTIRRFWRGDRGMNG
DVATRVTGSSDLYERSGRRPFASINFVTAHDGFTLQDLVSYERKHNEENKEGNEDGHDDN
HSTNCGVEGPTNDPEVIERRERRKRSIMATLLLSQGVPMILGGDELSHTRRGNNNPYCQD
NEISWYDWDLDEREQKFLEFVQRLTAFRQEHPSFRRRHFLDPVDESDGSGDVLWWHPDGR
EITDGDWHDEGLHAFGYLLRGQNLAPDSQGRPRTDDSFLVLMNQGGAPVEVEVPAETNEL
DDVHCAAWHVVPELAEFLDDPGPVEPGGVLTLRPHRLLVLRAEP
Download sequence
Identical sequences D5H7E8 Q2S497
gi|83815924|ref|YP_444984.1| gi|294506847|ref|YP_003570905.1| 309807.SRU_0849 WP_011403613.1.91540 YP_444984.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]