SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506933|ref|YP_003570991.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506933|ref|YP_003570991.1|
Domain Number 1 Region: 1100-1343
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.19e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.00034
Further Details:      
 
Domain Number 2 Region: 399-595
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.29e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.00012
Further Details:      
 
Domain Number 3 Region: 130-224
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.36e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00095
Further Details:      
 
Domain Number 4 Region: 1017-1103
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 5.62e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0052
Further Details:      
 
Domain Number 5 Region: 270-354
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000615
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0079
Further Details:      
 
Domain Number 6 Region: 227-269,377-431
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000022
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|294506933|ref|YP_003570991.1|
Domain Number - Region: 851-955
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00068
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294506933|ref|YP_003570991.1|
Sequence length 1398
Comment multidrug resistance protein [Salinibacter ruber M8]
Sequence
MWDRTTCPRAPRSALPSSTIAPRRRARRTRAARRFPPRRPTDQERLTVTQGDTLALRRGR
PCPSPRTAGIVPAAAHVPTDTLPRTIRPPAMKITNLSIKYRTAIAVFTLILAVGGLASYL
TIPKESNPSIEFPQIVVTSVYPGASPSDVESTVSQVIEQEISSINGIDEMRSTSSEGVST
IVVEFTPDVNTDKAYQEVNRAVDRAQPDLPEAVEEPLVDEINTDQFPIMTVNLSGTYSLA
RLKTVAEDLQDDLEGISSVLEANLIGGLTREVQVNVDLAALKNYNVSYNSLVNTIQQENT
NIPGGSIDVNRLNYLVRVDGQFDQPAQQIEELVVKTTANGRTVQVKDVADVIFGFKDRTS
YSRLRVLKRERADGETVSVPASERRTAQVISLNVTKRPGANILETSDAVKSTLDAFSFPS
GTEVLLTGDQSENVQSLVTDLENNIISGLIFVIAVLLFFLGVRNATLVGIAIPLSMFTSF
LVFQALGYTLNFIILFSLIIALGMLVDNAVVVIENIYRFREQGYSRWESARLGTAEVGGP
VVAATATTVSAFAPMLLWPGIIGEFMSYMPLTLIITLTSSLFVALIINPVITGFFVEVKG
RSNGEKGSSRWPALARYGGVGLILLLGVTLGIANWKTLVVVATAVPALYLLHVYVMSPIG
DRFVESGLPRLIRWYRGYLQRMLERDYSVPYAFLRNTGALTALAAGALLAAGGGLITTVA
GQTAGLLLLVPGGVLAALGALGVLVHTLESIYLGGWTSVKGGVGLLAVMLAVLGLNYLAG
GIGPGTMLRLAAAPVFVVGVGLIGALFNTRDRLLLTDTRAALLNGSLGGLVLIVGLYLVA
PTGQAFFPDTDPNRVQITAEAPLGTNIEASNRIAQTVGDRILKLLDQNPNSEANIENLLV
NVGVGGDAQFGGGAQQPERSRVSLNMVDYAERPESSTRTLEKMRAQLQGIPGTEIEFTKQ
EQGPPTGPPVNIELSGPEFERIVQISNEVKRRLTDAAQSGRLPGLVDVTDNLNTGRPEVQ
VDVDRAQAAEYGLSTSQIAQTVRTAIQGTEADTYRSGEDEYDITVRLQKQDRKSIESLGS
LTVTNPRGQQIPLTSVADIEEGTGFGSITRIDQNRVVTVSGAAAPGYNGPEVLTRVQDEL
SEYRQGLPPGYTMEYTGGNEDQQESFGFLTTALLIGASLILLILIVEFNSISAPFIIMVA
VGLSMIGVLLGLILTRTPFNLFTFIGIIALAGIVVNNNIVLVDYIMQLRGRGQDKQAAIV
EGGATRLRPVLLTALTTILGLVPLTFGINVDFVGLLADFAPNFQFGSENTQFWGPMGTAI
ISGLTFATFLTLVIVPVMYSVFDSVSLRLTTAFGGSSDDASIVSETVVTDSLLDDGSPGD
GAPAGDASTPQADRPSKT
Download sequence
Identical sequences D5H7N4
gi|294506933|ref|YP_003570991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]