SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507076|ref|YP_003571134.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507076|ref|YP_003571134.1|
Domain Number 1 Region: 51-173
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 5.06e-37
Family Insert subdomain of RNA polymerase alpha subunit 0.0000823
Further Details:      
 
Domain Number 2 Region: 12-51,174-228
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.75e-28
Family RNA polymerase alpha subunit dimerisation domain 0.0014
Further Details:      
 
Domain Number 3 Region: 251-320
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.44e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294507076|ref|YP_003571134.1|
Sequence length 328
Comment DNA-directed RNA polymerase subunit alpha [Salinibacter ruber M8]
Sequence
MSNHGLQMPEGVHVEEVSDSEGQFVMGPLERGYGVTIGNALRRVLLSSLRGLAITAVKID
GVQHEFSTIPGVTEDVADLILNLKEVRFKADEMQEGHLHLNLEGPGNWTAADIDEATAEY
DVLNPDQHVATLAEDAVVNVDLRVGYGRGYVPSEENKREDDPIGVIAIDSIFTPIKNVNY
EVKPTRVGQKIDYEELLLDVETDGSLTPEEAITQGASILRDHVSFFIQLEEEPEPVVEEQ
EVDEEVKRIRELLAQPVDELDLSVRSHNCLKAANIKTIGDLVRREEDEMLKFRNFGRKSL
QELVEVLDERGLQFGMDVEEYLEEKKAS
Download sequence
Identical sequences D5H827 Q2S3N9
gi|294507076|ref|YP_003571134.1| WP_013061621.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]