SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507165|ref|YP_003571223.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507165|ref|YP_003571223.1|
Domain Number 1 Region: 64-127,206-497
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 8.85e-36
Family Zn-dependent arginine carboxypeptidase-like 0.06
Further Details:      
 
Domain Number 2 Region: 5-65,496-540
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.63e-22
Family D-aminoacylase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507165|ref|YP_003571223.1|
Sequence length 546
Comment metallo-dependent hydrolase [Salinibacter ruber M8]
Sequence
MPPSEFLITNARVYPVNGGTDRPVPASALAVRGGRIAAVGSPAEASTAVPEARRIDAEGR
TVVPGFVDAHAHLHELGLALRRADLTDASSPDAVVKQLRAFVADHDPPSDAWLRGHGWDQ
TEWTPARLPSRSALDAAFPERPVWLTRTDVHAGWANTAALEATVGLDRLHEMSDPDGGHI
HRDRTGIPTGVLIDAAMALVEDHIPPPSAAHQDRALSTALRHTARRGITSLHDAGVGLSA
LRRVRDFLEEDRFPLRLYAMIDGRGETLEHFCDRGPLHHPSGRLGVESVKFFADGALGSR
GAALLDDYADAPGTRGFLLHDSNAFREHVRVAHERGFQVNTHAIGDRANRQVLDAYEHVA
RESTRPLRRPRIEHAQIVAPDDRPRFGRLGVIASVQPAFAPSDHGWAPARLGPDRLTDAY
AWRSLQEAGARLAFGSDAPVEPADPIRGFHAAVTRRDAGGAPNGGWQPDERLPRATALYA
HTQGAAYAAFQEDEIGSISVGKRADFVVLSQDLMTVPSDRLLDTEVVATYLGGTPVHTTP
DWPDAH
Download sequence
Identical sequences D5H8B6
WP_013061698.1.91540 gi|294507165|ref|YP_003571223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]