SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507273|ref|YP_003571331.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507273|ref|YP_003571331.1|
Domain Number 1 Region: 404-765
Classification Level Classification E-value
Superfamily UROD/MetE-like 6.8e-120
Family Cobalamin-independent methionine synthase 0.00000000203
Further Details:      
 
Domain Number 2 Region: 4-402
Classification Level Classification E-value
Superfamily UROD/MetE-like 1.44e-118
Family Cobalamin-independent methionine synthase 0.0000000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507273|ref|YP_003571331.1|
Sequence length 769
Comment 5-methyltetrahydropteroyltriglutamate/homocysteine S-methyltransferase [Salinibacter ruber M8]
Sequence
MATASNLGYPRIGAHRELKRAVEGYWKGDLTKDELRDSAQALRESHWATQQELGLDVVPS
NDFSYYDQVLDACAMVGAVPERFPWDGTEVDLDTYFAMARGLQEKDLEGEESGVQAMEMT
KWFDTNYHYIVPEFSHDTTFSLSSTKVIDEYEEAKAQGVDTRPVVIGPVSFLLLGKTQAD
DLDALDLLDDLLPVYAEVLQELADAGCEAVQLDEPNLVLDLSDAERAALDQAYEALADAA
DIELHVATYFGGLEDNLPTALDLPVDVLHLDLTRGEEQLDEALDHGVPDDLALSLGVIDG
RNVWRADLDALLGTVEAAIDALGTDRVLVGPSCSLLHVPVDLDTEPGLSDEMKTWFAFAT
QKIEEIVALAERADGHEDATEALFEKSRRAHAARAESDWINDAAVQDRVAGIDASMTERD
SPHSSRSPLQREALDLPTLPTTTIGSFPQTDDMRRMRAQYKKDEISKDEYEDFIEEQIAD
TIAAQEEIGLDVLVHGEPERGDMVEHFGRQLDGFLFTENGWVQSYGTRCVRPPIIAGDVS
RPEPMTTRWLSYANDQTDTPVKGMLTGPVTMLQWSFVRDDQSRAETCRQIALAIRDEVLD
LEDVGIQAIQIDEPAFREGLPLREHQWDDYLDWAVECFRLASSGVRDETQIHTHMCYSEF
NDIIEAIADMDADVISVEASRSKMELLDSFDAFDYPNEIGPGVYDIHSPRVPSVEEMEEL
IRTALDALEPSQMWVNPDCGLKTRRWVEVQPSLENMVQAAENVRERATA
Download sequence
Identical sequences D5H8M4
gi|294507273|ref|YP_003571331.1| WP_013061793.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]