SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507412|ref|YP_003571470.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507412|ref|YP_003571470.1|
Domain Number 1 Region: 230-350
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 7.53e-23
Family Cytidine deaminase 0.0016
Further Details:      
 
Domain Number 2 Region: 101-171
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000000000452
Family Cytidine deaminase 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507412|ref|YP_003571470.1|
Sequence length 356
Comment Cytidine and deoxycytidylate deaminase zinc-binding domain-containing protein [Salinibacter ruber M8]
Sequence
MLFATSRLNPEVVSLLGGHKALAYGKFGRLIGHTAAWGCGKNDLDPNLSTSRFDRKVAPR
LSLVQTGTSSRFHRFPPVQFVNFGSPPRLMPPSDSALDPPRRRARDLLPRAHVPFSDAPT
AAVLLLDDGRWVPGVRLESASYSLTIPALLNAYTTAVALGHESSIVAFVLSRPFRREEAL
YVEDLPQGPFEPAADDAWVRGAGGNGALPALQAVLPPDLDVSIDGTEDGLQAVRRVSGRA
HVPSSGYPVGAILETQEGPSVPGVNVEHPDWARILCAERNVLGTMHSYALPSPRRLYLTC
DEDPEGTPCGACRQLLAELAPEATLWMDRHDAAPERSSASALLPGSFRGRALLDAS
Download sequence
Identical sequences D5H913
gi|294507412|ref|YP_003571470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]