SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507553|ref|YP_003571611.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507553|ref|YP_003571611.1|
Domain Number 1 Region: 16-251
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.65e-86
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 255-355
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 2.51e-26
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507553|ref|YP_003571611.1|
Sequence length 373
Comment DNA polymerase IV [Salinibacter ruber M8]
Sequence
MSGYDPDGTSGNDTEKDARRIVHVDMDAFYAQIEQRDFPDRYAGKPIAVGGNPPRGVVQT
ASYEARPYGVHSAQPAVEADRKCPDLIFVSPRMDVYQEESKRIRKILRRYTDLVEPLSLD
EAYLDVTEPKTGRPSGTLIARRLRAEIYEETGLTASAGVGPGKFVAKVASDLDKPDGLTV
VRPDEQMEFIAQLPIEKFHGIGPVTAAKMQELGIQTGADLQETPERTLIHHFGKRGRHFK
TLAVGTDDRPVQPDRDRKSVGAERTFPEDIARAETMLERLSPIAERVAQRLRQANRKGRT
VTLKLKSHDHQVSTRQTTVDRPLRAEDALMTITERLLRRPHPLDEPVRLLGISVSSLTEE
ERAGGQLEFDFRP
Download sequence
Identical sequences D5H9F4
WP_013062029.1.91540 gi|294507553|ref|YP_003571611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]