SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294507583|ref|YP_003571641.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507583|ref|YP_003571641.1|
Domain Number 1 Region: 143-305
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 7.44e-82
Family SCOPe 0.0000186
Further Details:      
 
Domain Number 2 Region: 2-139
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.17e-59
Family LDH N-terminal domain-like 0.0000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507583|ref|YP_003571641.1|
Sequence length 314
Comment malate dehydrogenase [Salinibacter ruber M8]
Sequence
MKVTVIGAGNVGATVAECVARQDVAKEVVMVDIKDGMPQGKALDMRESSPIHGFDTRVTG
TNDYGPTEDSDVCIITAGLPRSPGMSRDDLLAKNTEIVGGVTEQFVEGSPDSTIIVVANP
LDVMTYVAYEASGFPTNRVMGMAGVLDTGRFRSFIAEELDVSVRDVQALLMGGHGDTMVP
LPRYTTVGGIPVPQLIDDARIEEIVERTKGAGGEIVDLMGTSAWYAPGAAAAEMTEAILK
DNKRILPCAAYCDGEYGLDDLFIGVPVKLGAGGVEEVIEVDLDADEKAQLKTSAGHVHSN
LDDLQRLRDEGKIG
Download sequence
Identical sequences D5H9I4 Q2S289
gi|294507583|ref|YP_003571641.1| 3nep_X gi|83815628|ref|YP_445692.1| 309807.SRU_1571 WP_011404318.1.91540 YP_445692.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]