SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507627|ref|YP_003571685.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507627|ref|YP_003571685.1|
Domain Number 1 Region: 66-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.03e-63
Family Prokaryotic proteases 0.0000115
Further Details:      
 
Domain Number 2 Region: 288-393
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-21
Family HtrA-like serine proteases 0.017
Further Details:      
 
Domain Number 3 Region: 422-510
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000213
Family HtrA-like serine proteases 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507627|ref|YP_003571685.1|
Sequence length 519
Comment periplasmic serine protease DO-like [Salinibacter ruber M8]
Sequence
MSTQGKVSLAVVVGGAFLAGILFATAGANLFGVGDAVGTSSQAANLDGSTQIEQPPPNTP
NGFETAFSEVAQSVNPAVVQIRAAKVVDRRMRNPFEGTPFERFFGQRGPSEPEVRQGLGS
GVVVRSDGHIVTNNHVIQDAERLSVQTLDGEQYEAEVVGTDPYKDLAVLKVDASDMTAIS
FGNSEQVSVGQWVMAFGSPLDPQLNNSVTAGIISALGRLQASPQRGRSSSQGGGVQNFIQ
TDAAINPGNSGGPLVNLQGELVGINTAIVSRSGGNQGIGFAIPSSTVERIATQIIEEGDV
RRAYLGIRYGGAPETLVDNENLPKGSAVVSQVEEGAPADEAGLEAGDIITGINGTPLEDY
LQLGNQIASMRPGEEAELQINRDGEARTLTVTLGARGESMTASSEDRSESNGPSTAEALQ
EELGLQLQGVTPEMARRLGLDEAQGVVITGVDQSNRMIRESGLQPRQIIFKMAGEQISDM
DTFMEVYRSVEPGDAFRMAVRNPDGFVFVTSLRRPADTE
Download sequence
Identical sequences D5H9M8
WP_013062091.1.91540 gi|294507627|ref|YP_003571685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]