SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507656|ref|YP_003571714.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507656|ref|YP_003571714.1|
Domain Number 1 Region: 222-528
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.31e-110
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000635
Further Details:      
 
Domain Number 2 Region: 9-200
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 6.8e-63
Family Inosicase 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507656|ref|YP_003571714.1|
Sequence length 528
Comment bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Salinibacter ruber M8]
Sequence
MPPDAPSPVRRALLSVYDKTGIADFARRLRSLDVELISTGGTADTLRDAGIDVTDVADVT
GVPEVLEGRVKTLHPALHAGILARRSREDDLAALDEHDYAPIDLVVGNLYPFSEAVQDPD
ADPETVMEYVDIGGPTMLRAAAKNHFDVGVVSAPDQYAAVADELEQNDGHLSAPTRRRLA
EAAFAHTAAYDQDIDAHLSRASGADADGDGDLQPTYNVALPQAQSLRYGENPHQEGALYG
DPSPFYDKLHGRALSYNNLLDTSSALALIDEFRDAGPTCAILKHTNPSGVATADTLEEAW
HQAFATDTQSPYGGIVVVNQALDRATAEAIDEIFTEIVIAPEFEPGVLEFLTEQDRRRVV
RAKQPARGTDRLDVRSVLGGLLVQTRDPALPPAATARDGWEVPTARAPSDDERADLDFAW
RVAKHVKSNAIVYARDQATLGVGAGQMSRIDASELAVFKAEKSELDLTGSVVASDAFFPF
ADGLEAAANEGARAAIQPGGSIRDDDVIEAADAHDVAMILTGQRHFRH
Download sequence
Identical sequences D5H9Q7
WP_013062115.1.91540 gi|294507656|ref|YP_003571714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]