SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507723|ref|YP_003571781.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507723|ref|YP_003571781.1|
Domain Number 1 Region: 6-350
Classification Level Classification E-value
Superfamily UROD/MetE-like 8.37e-121
Family Uroporphyrinogen decarboxylase, UROD 0.00000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507723|ref|YP_003571781.1|
Sequence length 354
Comment uroporphyrinogen decarboxylase [Salinibacter ruber M8]
Sequence
MASFPSLDNDRLLRTARGEPTDCTPVWMMRQAGRYLPEYQAIRKEHSFFEVVETPELAAE
VTIQPVERFSLDAAILFCDIMVVPEAMGLTVKMVSGQGPTFPKPLTTPDEMERLVEPDVE
SALGHVFEALTVTRHELAGRVPLIGFSGAPWTLMAYMVEGGGSKSYRAARRWLYRHPDAS
KALLQRTTDVIVEYLIRQVDAGAQMLQVFDSWAGLHTPENFRTFCLPYLAEIATRVKAAH
PDVPLVIFAKGAHYALDALADTDYDVISLDSTMDPDAARDTVGDRAVLQGNLDPCALYAP
PDVLRREVQHMLAGFGPHHHIGNLGHGMLPDHDPEHARVFVDAVHEHSRHMRTV
Download sequence
Identical sequences D5H9X4 Q2S1W0
gi|83815293|ref|YP_445821.1| 309807.SRU_1702 gi|294507723|ref|YP_003571781.1| WP_011404447.1.91540 YP_445821.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]