SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507732|ref|YP_003571790.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507732|ref|YP_003571790.1|
Domain Number 1 Region: 27-197
Classification Level Classification E-value
Superfamily PRTase-like 9.31e-46
Family Phosphoribosyltransferases (PRTases) 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507732|ref|YP_003571790.1|
Sequence length 199
Comment Hypoxanthine phosphoribosyltransferase [Salinibacter ruber M8]
Sequence
MASNMPATRDLLETPVQPTDAAVTVQGERFRRYLSAERIKKRVAEMGQTIARDYATTTPI
LVSVLNGAFMYTADLMRAIDTDCEIDFIKLSSYGDEKVSSGEVRELKSVDAELEGRDVLV
VEDIVDTGLSMEFMKRRLAEYNPASLRVSTLLHKPTATEPDLTLDYVGFRIPDLFVIGYG
LDYGQLARNLSDIYILDEG
Download sequence
Identical sequences D5H9Y3
gi|294507732|ref|YP_003571790.1| WP_013062168.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]