SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507734|ref|YP_003571792.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507734|ref|YP_003571792.1|
Domain Number 1 Region: 135-332
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-50
Family DNA gyrase/MutL, N-terminal domain 0.00000945
Further Details:      
 
Domain Number 2 Region: 599-784
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 3.79e-44
Family DNA mismatch repair protein MutL 0.0055
Further Details:      
 
Domain Number 3 Region: 342-464
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-31
Family DNA gyrase/MutL, second domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294507734|ref|YP_003571792.1|
Sequence length 784
Comment DNA mismatch repair protein mutL [Salinibacter ruber M8]
Sequence
MCRGAPETRKMRRGKRRAEGRRTPHLGNDGSDRPVRSGAQAFDTQPTRPWVCSVPGAGPG
RSTTSPATTIPRRTTTATSDGGCSPAVPRRHSAARSACCSSWPSCFSRCSSTTRCKFSQS
VRAVADESSPSGGLIEVMSDRLANQIAAGEVVQRPASVAKELIENALDAGASSIEVLLKD
AGSTLVQVIDDGCGMGPGDAERCFERHATSKLRSVDDLERIRTLGFRGEALASIAAVAQV
TLKTKRVEDDAGTLVRVEGGEQVEKRPCAIPNGTSVAVRNLFFNVPARRNFLKTPATELK
HLTQTVQSLALANPDTAVRLEHDGHEHYDLPAAPDSDWHAATRARILGLFGGDHEDELVA
VEDESSDLRLRGFVGAPSFHRKTRGEQFLFVNGRAVTDRYLSHAVKKAYGELVPDGAFPF
FALFLAMNPERVDVNVHPQKEEVKFDDQSGIYGFLRSAVRRALGRVHVSPQMDDGDDEAD
NEEDSPGPESDGTGSGGHAVSGDGTSSPRPTPTSFQPQRSSGDATDSSGRSSSGPSPQSP
KPRPENPSVSPGDQSDALYRRPDGGDESSPGDAPASPPHREGGSSSTSAADGAERSGRRP
VWGLHDTYVVTPTETGMMLVDQRAAHLRVLYERARAHLRDQQGASQRLLFPHTVDLSPAE
VELLDELRDDLDALGFELERLSGRTVSVRGVPADVPDGNEDTILEELLEQYRSAQDAVED
ERREHLAKTMAQRSAVDRGQPLSEEERRALLDDLFDCEMPYADPTGTPTIVKLSMEELAD
RFGR
Download sequence
Identical sequences D5H9Y5
WP_013062170.1.91540 gi|294507734|ref|YP_003571792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]