SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507871|ref|YP_003571929.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507871|ref|YP_003571929.1|
Domain Number 1 Region: 107-201
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000124
Family PDZ domain 0.019
Further Details:      
 
Domain Number 2 Region: 212-284
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000197
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507871|ref|YP_003571929.1|
Sequence length 480
Comment Membrane-associated zinc metalloprotease [Salinibacter ruber M8]
Sequence
MELVVSVLTSTLWVLLALTILVFVHELGHFLTAKYFDMRVERFSIGFPPTLFGRTYGDTE
YAVGATPLGGYVKISGMIDESLDTDHVETDPEPWEFRGKPVWQRIIVISAGVIFNAILAI
VIFGGLSWSEGDTYIPAENVEQVYVEEGSVAHDLGLRTGDRIVRVNGSDFERFRQVEPSS
LIAADTLTITVVRDGERQTITGPPNFISRLSRARSNEQGFGLGFQPALIGAVEAGSPADS
VGLQTGDRIYALQSDTVRFWREMSARLQQAEGARVAMRWFRPDSLVGESDRSRSPRVVRR
TSQGVVFADSVAARYDSKRERYLLGVRSPRASSVTRQALFDEFGIRTVTYGPLAALKAGA
VDTWTYGRNIVVTLKRIAEGRDSLTDSLGGPVMIADVTSEAAAAGATAYWRLIAALSITL
AIMNILPIPALDGGQLLFLLYEAVTRRRPSVRVRLVAQQVGMILLIGFMAFLIFNDILRL
Download sequence
Identical sequences D5HAC2 Q2S1H1
WP_011404585.1.91540 YP_445960.1.20240 gi|83814616|ref|YP_445960.1| gi|294507871|ref|YP_003571929.1| 309807.SRU_1848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]