SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507935|ref|YP_003571993.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507935|ref|YP_003571993.1|
Domain Number 1 Region: 71-127,460-493
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 5e-17
Family Hydantoinase (dihydropyrimidinase) 0.065
Further Details:      
 
Domain Number 2 Region: 127-343,386-461
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.0000000034
Family Zn-dependent arginine carboxypeptidase-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507935|ref|YP_003571993.1|
Sequence length 614
Comment amidohydrolase [Salinibacter ruber M8]
Sequence
MDGRMDATTRMTLSVGALMFRMIWFPAPHWTHAARMTASTFRRYGFGLLSLVLLVLPSRL
AAQDYEVPTVTDTYALQNARVVQAPGQVLESATVVVRDGVIDAVGPDAEVPYDARTIEAD
SLVVYAGFIDGLSHAGVEMPEGEDTDVEDPGNPPPDAAGIQPDRSVRPFLSPDESALQSL
RKAGFTLGHVAPEGQMLPGASAHVFYGGETANDMVLEAGPTLFAQLQTADGYVYPATGMA
VIAQMRQLYREAERRQQLEAAYERDPTGRPQPPQDPQHSALFSVLDGEQPLAFYADEALS
LHRILALHQELDFPLVLAGLGESHELVDALQAVDAPLFLTLDLPEEPTRSTGQDTTTADT
TSTPSRYYNPDLQVPSHETVAEEEENLELRHAMERQDYLETAATLHDAGLEFGFTTREAD
PGDVRGNLRTMIDQGLPEQTALAALTTRPAAQLGLDDRLGTVEAGKIANLVVTDGSYFAE
DTKVTHVFVDGRLYDYSADGSDEGEVSGDVSAVLGTWSYTLDTPQGELSGEVTIEGDQSG
LDGTFVGPQGDEQPLQSVSFDGTTLSFTVDSPQGGSVSVSVTVEGDTFDGSASTSGGSFP
ISGERTSGPNATQK
Download sequence
Identical sequences D5HAI6 Q2S1B2
gi|83816733|ref|YP_446019.1| SrR164 309807.SRU_1909 gi|294507935|ref|YP_003571993.1| WP_011404644.1.91540 YP_446019.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]