SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507936|ref|YP_003571994.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507936|ref|YP_003571994.1|
Domain Number 1 Region: 92-386
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.52e-27
Family alpha-subunit of urease, catalytic domain 0.031
Further Details:      
 
Domain Number 2 Region: 27-93,385-420
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.03e-24
Family Hydantoinase (dihydropyrimidinase) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507936|ref|YP_003571994.1|
Sequence length 475
Comment amidohydrolase [Salinibacter ruber M8]
Sequence
MPSAFPSPYRSVFGVLAAMLLWAAPTQAQDQLRGDAPDDWLIQDATVLTVTNGTIENGDI
LVRDGDIARVGQDLSAPSGVETYDASGEYVMPGIVEAHQHMAISDVNEATNPVTAEVGVG
DVLNPYDIGIYRALAGGVTTAHVMHGSANPIGGRNETIKLRYGVTNPDRLQMDGAPRTIK
FALGENPTGLYGQGRDQVPRTRMGVEQVIRTALTKAERYMEAKQAYQDGERARPPAHSER
MEVLARVLRGDILVQTHGYRADEMLMLMDVFEDFGIQDLVFHHANEGFKIAPELAAFGDN
GAGATVFSDWWSYKFEVYYSTAYNAAVLAENGVNASINSDIPGEQRDLYLQAAKTQRYGD
LSDTQALRLITINPARQLGIADRVGSIEEGKAADLALFSEHPLSVYTEPQRTYVDGVVRF
DHEEDPDDMRLRVDPEGTVNLARDGWSRHAAHSCLKGVAQLRATRNGVSLENTGR
Download sequence
Identical sequences D5HAI7 Q2S1B1
NYSGXRC-9641a SrR162 gi|294507936|ref|YP_003571994.1| 309807.SRU_1910 gi|83814482|ref|YP_446020.1| WP_011404645.1.91540 YP_446020.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]