SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507937|ref|YP_003571995.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507937|ref|YP_003571995.1|
Domain Number 1 Region: 92-392
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.00000000000000221
Family Imidazolonepropionase-like 0.05
Further Details:      
 
Domain Number 2 Region: 40-93,391-424
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0000000000000025
Family N-acetylglucosamine-6-phosphate deacetylase, NagA 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507937|ref|YP_003571995.1|
Sequence length 447
Comment amidohydrolase [Salinibacter ruber M8]
Sequence
MLSPFCPRPQRVFAGLTLLVALLLALPAHAQKQPGFQGPFALTNAQVIVAPGDTLDDGTV
VIRDDSIAAVGPNVSVPSDAQAFDLSGQMVYPGFIDSGTHLGLAEIGSLPETQDFNEIGD
LTAHMNALTAVNPSTVHVPTTRAHGITSVITEPENGILPGTAALIGLHGYTPEQMHLGDV
TLTKLNFPSVGRQGPSDDRSPETIQKEAEKALTQLNDLWAQAERYARIDSAVAEQPEARR
QPEFVPAMEGLLPVIRGEQPLMISANAAADISKALDWAEERGVLDQLILSGALEGWRVAD
EIAAANVPVLVGSIMQPPSRESDRYDKAYRTPSLLHDAGVTVALRSGKTENVRNLVFHAG
FAAAHGLGKTEALRAITTTPARIFGVADQVGTIEAGKRANLFVADGDPLQPATDVQHLFI
DGYKLPLENRATKLYDEFRNRNPGLTK
Download sequence
Identical sequences D5HAI8 Q2S1B0
NYSGXRC-9655a SrR152 WP_011404646.1.91540 YP_446021.1.20240 gi|294507937|ref|YP_003571995.1| 309807.SRU_1911 gi|83815248|ref|YP_446021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]